KEGG   Chitinophaga pinensis: Cpin_3590Help
Entry
Cpin_3590         CDS       T00959                                 

Definition
glucan endo-1,6-beta-glucosidase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
cpi  Chitinophaga pinensis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cpi00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:cpi00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4474792..4476252
Genome map
AA seq 486 aa AA seqDB search
MNKKLWVYACCIGAFLAACDNGQQQSGGGGQHDSVAVYLTTPDQQQLFVKQSAIGKTKDT
SAINIVMDTTRQFQEIEGFGASVTGSSAYVMQNYMSADKRQALLEELFGAENGLGINYIR
MSIGASDFSTDPYSYDDMPAGQRDDSLTHFSIAHDEKDVAPVLKQISGINPNIHIMGSPW
SPPGWMKTSGKLEGGSLRPDAYAVYARYFVKYIQAFAAAGVKITALTMQNEPQYEASYPS
MKMTAPEQGTFIKDHLGPLLEKEGLHKQVSVMLFDHNWNSPEYPISILDDSAMAKYTAGA
AFHCYEGAVGAMSKVHDAHPEKGLYFTECSGGSWSPEFADNLQYMVRQLFIGTMNNWSKN
VLLWNMALDEHNGPTTNKPGTGKENRGCMTCRGVVTVNSKDGGVTRNVEYYAIAHFSKFV
RPGAKRVYSSALADKGVENVAFLNADGSRVMVVINTTKDERVFSVQEGDIVSYGLKPGAV
VTLVWK
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagaaattatgggtgtacgcttgttgtataggtgcctttctggcggcctgtgac
aatgggcagcagcaaagtggtggtggcggacagcatgattctgtagccgtttatctgaca
actcccgatcagcagcagttgtttgttaaacagtctgcaataggtaaaacgaaagatact
tccgctatcaatattgtgatggataccacgcgtcagttccaggagatagaaggcttcggc
gcttcagttacgggttcttccgcttatgtgatgcaaaattatatgtctgccgataaaagg
caggctttgctggaggagttattcggtgcagaaaatggtcttggcattaactatatccgg
atgtctatcggtgcgtctgatttttctacggatccgtatagttatgatgatatgccggcc
gggcagcgggatgattctttgactcatttttccattgcgcatgatgagaaggatgttgcg
ccggtgttaaagcagatcagcggtatcaatcccaatattcatatcatggggagtccgtgg
agtccgccgggatggatgaagaccagtggtaaactggaaggtggttctttgcgtccggat
gcgtatgctgtttatgcgcgttacttcgtgaaatatattcaggcttttgcggcggcaggt
gtgaagattactgcgttgacgatgcagaatgagccgcagtatgaggcgtcttatccgagt
atgaaaatgacggcgcctgagcaggggacttttatcaaagatcacctgggaccgttgctg
gagaaagaaggcttgcataagcaggtatctgtgatgttgtttgatcataactggaatagt
ccggagtatccgatttctattctcgatgacagcgcgatggcgaagtatactgctggtgct
gctttccattgttacgaaggagccgtgggagcgatgtctaaagtacatgatgcgcatcct
gagaaagggttatatttcacggaatgttctggtggtagctggtctccggagtttgcggat
aacctgcagtatatggtgcgtcagttgtttattggtacgatgaataactggtcgaagaat
gtgttgttgtggaatatggcgttggacgagcataatggtccgacgacgaataaaccgggt
acgggtaaggagaatcgtggttgtatgacttgtcgtggtgtggtgacggtgaattctaaa
gatggcggtgtgacgcgtaatgtggagtattatgcgatcgcgcattttagcaaatttgtg
cgtccgggggcgaagcgggtttattcttctgcgttggcggataaaggtgttgagaatgtg
gcatttttgaatgcggatggttctcgtgtgatggtggtgatcaatacgacgaaagatgag
cgggttttctctgtacaggagggggatattgtgagctatggtttgaaaccgggcgctgtg
gttacgctggtttggaagtaa

DBGET integrated database retrieval system