KEGG   Chitinophaga pinensis: Cpin_4161Help
Entry
Cpin_4161         CDS       T00959                                 

Definition
cytochrome C peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cpi  Chitinophaga pinensis
Brite
Enzymes [BR:cpi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Cpin_4161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5191837..5193633)
Genome map
AA seq 598 aa AA seqDB search
MKLSKSLIAGVIVLSTWLSCTNTTPFATTSSSADLDSLVHQWLNQHMDSLEAGATRLQSL
AATPAKEAELRAAFSDCRRLFKQLEWFSVYYAPATSRQLNGPPLPEIEVEENKMSDPAGL
QVMEELLFPYDTSASAALLKEAKGFISSLIPLRHTIENTRFDTAHIFDACKMEVFRVEVL
GISGFDTPLCGWGIPETGVALSAVKEMMAFIAAPDNLLKRLDRVIAVTEQATSPGEFDYA
LFMSQQLHPLSAAMTDWFYSAGLQPIAYPQALKNTARTLFDSSAFNTAYFVHNADAVPTP
EKVALGKMLFYENRLAGNGQRSCSSCHMPEKALTDGMPKNTSLDGSATVLRNTPTLLYAG
LQQAQFYDMRSPTLENQVLDVLHNEAEMQSSPEKVASWLNQEPALKSQFKAAFPDIQDTI
LPRHVTRAIAAYIRELHPFRSNLDNYMRGDSNALTGQQKKGLNLFMGKARCATCHFMPLF
NGTAAPSFATTESEVLGVLVAPGVAKLDPDMGRYTHTQLEGLQYAFKTPTIRNIAKTAPY
MHNGAYKTLDEVMEFYNKGGAAGYGIDLPGQTLSADPLHLSEEEKKSIIAFMESLTDH
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcagcaaatctttgattgccggtgtaatcgtcctcagtacctggctatcatgt
accaacaccacaccatttgcaacaacaagcagttctgcagacctggacagccttgttcac
cagtggctcaatcagcatatggattccctggaagcaggcgctacgcgtttacagtcactg
gcagcaacaccggcaaaggaagcggaactacgggctgcttttagtgattgcaggcgattg
ttcaagcaactggaatggttcagtgtttattatgcaccggctacttcccgccagctaaac
ggaccacctttaccagagatagaagtggaagagaacaaaatgagtgatcctgcggggctg
caggtaatggaggaactgttattcccctatgatacaagcgcatccgctgcactgttaaaa
gaagcaaaagggtttatatccagcctgattcctctcagacataccattgaaaatacccgt
tttgataccgcccacatctttgatgcctgtaaaatggaagtattccgcgtggaggtattg
ggtatcagtggttttgatacgcctttgtgtggatggggcattcctgaaacaggcgtggca
ctgtcggctgtaaaggaaatgatggcctttatagcagcgccggataatctccttaaaaga
ctggatcgagtaatagcggtaacagagcaagcaacaagtcccggtgaatttgactacgcg
ctatttatgtcccaacagctacatccactttcggcagcaatgaccgactggttttacagt
gccggcttacaacctattgcatatccgcaggcactgaagaataccgcgcgtaccctgttc
gacagcagcgcctttaataccgcttatttcgtacacaatgcggatgcggttcctacgccg
gaaaaggtggcactgggaaaaatgttattctatgaaaacagactggccggtaacggtcag
agaagctgtagcagctgtcacatgccggagaaggcattgacggacggtatgcctaaaaac
acttcccttgacggcagtgccaccgtactgcgcaataccccgactttattatatgccggt
ctgcaacaggcccagttctatgatatgcgttccccgacgctggaaaatcaggtgctggac
gttctgcataacgaagccgagatgcagtcttctccggagaaagtagccagctggctgaat
caggagcccgctttaaaatcgcaatttaaagcagctttcccggacattcaggatactata
ctaccaagacacgttacaagggcgatcgccgcttatatccgcgaattacaccctttccgc
tcaaacctggacaactatatgagaggtgacagtaatgcgctgacggggcagcagaaaaaa
gggctgaaccttttcatgggaaaagcgcgttgtgccacctgtcactttatgccgcttttc
aacggtactgcagcgccctcatttgccaccacagagtcggaagtactgggtgtactggtt
gctcccggagtagctaaactggatcctgatatggggcgatatacgcatacacagctggaa
ggactgcaatatgcctttaagacgcccactatccgtaatatcgctaaaacggctccttat
atgcataatggcgcttataagacactggacgaggtaatggaattctataataaagggggg
gctgccggttacggtatcgatctgccgggtcagacgctgtctgcggatcccttgcattta
tccgaagaagaaaagaaaagcatcattgctttcatggagtcattgacggatcactaa

DBGET integrated database retrieval system