KEGG   Chitinophaga pinensis: Cpin_4356Help
Entry
Cpin_4356         CDS       T00959                                 

Definition
glucan endo-1,6-beta-glucosidase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
cpi  Chitinophaga pinensis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Cpin_4356
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Cpin_4356
Enzymes [BR:cpi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Cpin_4356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5417601..5419412
Genome map
AA seq 603 aa AA seqDB search
MKKIYLRLAAAGMLCIAFYACKKNINTTDAIDDGQTVARANESVSIWMTTGNQSALLQQQ
GNVTFAPDAGTSGTTITVNEGTTYQGIDGFGYTLTQGSAKLINNLSASAQTSLLNELFSP
SSGIGISVIRLGVGATDLSDYSYTYRDGASFSLSGPDLTYTIPILKKILAINPAIKVIAT
PWTAPRWMKTNGSFVGGTLKAENYESYGQYWLDYMNAMRGQGIEIWAITPQNEPLNPYNE
PSMTLTKENQLGLINDYIGPKLRGAGFNCKIICYDHNCDNTEYPIYVANNSTYVDGSAFH
LYGGNVSAMTTVKNATNKNVYFTEQYTSVGGSFSGDLSWHIQNVVIGSLNNWSKTVLEWN
LISDSQGGPHTPGGSTVSMGAVTIDGGNIVRRVGYYIIGHVSKFVRPGAVRIGSNNSGNI
QTTAFRNSDGSKVLLAFNNGGGNVSFKVKWGSQSFTYSLPGGAAATFKWAGTTTTPTGPI
GQSVTLKGFNNQYVSSENGTQAMNCNRPTASGWETFSVVDAGGGKIALLSQGKYVSSENG
TQAMTCNRLTIGDWEKFDWVVNADGKISLRGSNGQYVSSENGTQPMNCNRATISGWEAFG
VNQ
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatttatcttcggcttgccgccgcaggcatgctttgtattgcattttatgca
tgtaaaaagaacattaatacaacagatgcaattgatgacggtcagacagttgccagggca
aatgaatctgtaagcatctggatgactaccggcaaccagagtgcgctcctgcaacaacag
ggtaacgtcacatttgcgcctgatgcgggtaccagtggcaccaccattacagtgaacgag
ggaactacttatcagggtatcgacggtttcggatacacactgacccagggtagtgccaaa
ttaatcaacaatctgtcagcatccgcacaaacgtccctgttaaatgaactgttcagtcca
tccagcggtatcggtatttcagtcatccgtcttggcgtaggcgccactgacctgagtgat
tattcctatacctatcgcgatggcgcttcctttagtttatctggtccggatctgacctat
accattcccatcctgaaaaagatcctggcgattaaccccgcgatcaaagtcatcgcaact
ccatggactgctccccgctggatgaaaacaaacggctctttcgttggcggtacactcaag
gcggaaaactatgaaagttatggtcagtactggctggactatatgaacgccatgagagga
cagggcatcgaaatctgggcgattactccccagaacgaacccctgaacccttacaatgaa
cccagtatgacactgactaaagagaaccaacttggcctgatcaatgactatatcggtcct
aagttaaggggcgctggtttcaactgtaaaatcatctgttatgatcacaactgtgataac
acagagtatcctatttatgtagcgaataacagtacttacgtagatggatctgcatttcac
ctgtatggcgggaatgtctctgctatgacaaccgtaaagaacgccactaataagaatgtt
tacttcacagaacaatatacttctgtgggcgggagcttttccggagacctgtcctggcac
atacagaatgtagtaatcggttcattgaacaactggtctaaaacagtactggaatggaac
ctgatcagcgattctcagggcggtcctcatacaccaggaggcagcacagtatccatgggc
gctgtgacgatcgatggaggtaacatcgtacgccgtgttggctattatatcatcggacac
gtatctaaattcgtccgccccggcgcagtacgtattggctctaacaattccggtaatatc
cagactaccgctttcagaaacagcgatggttctaaagtattgctggcgtttaacaacggt
ggcggaaatgtttcattcaaagtgaaatggggtagtcaatcctttacctactcactgcct
ggtggtgctgccgctacgtttaaatgggctggcactaccactacacccacaggacctatc
ggacaaagcgttaccctgaaaggttttaataaccaatacgtgagcagcgagaatggtaca
caggcaatgaactgtaacagaccaactgcttccggatgggaaaccttttctgtagtagac
gccggcggagggaaaatagccctcctctcccagggaaaatacgtatcatcagaaaacggt
acacaggccatgacctgtaaccgtcttacaattggtgactgggagaaatttgactgggtt
gtcaatgccgacggcaaaatatccctcaggggtagtaatggtcagtatgtaagttctgaa
aacggaacacaaccaatgaattgtaaccgtgccacaatatctggttgggaagcctttggc
gtcaatcagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system