KEGG   Chitinophaga pinensis: Cpin_4460Help
Entry
Cpin_4460         CDS       T00959                                 

Definition
cytochrome C peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cpi  Chitinophaga pinensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5551872..5552909
Genome map
AA seq 345 aa AA seqDB search
MHRLQLILITGFSLLLLACSKSDDILAFIGFKKPAHFPAPVYKLENNPVTQEGFELGRKL
FYESRLSRNNTVSCGFCHLQTAAFTHHGHDVSHGIDDRLGSRNSPPIMNLAWNTTFMWDG
GVFDLDLQPIVPITNPVEMDETVENVLNKLRNTAPYPAMFKKAFGTEEITTARMMKALSQ
FMVMLVSDQSKYDSVIRKQGPVFTQEEQQGYTLFQQKCSSCHKEPLFTDQSFRNNGIGTG
PNNDEGRYSVSLNAADKYRFKVPSLRNLAYTAPYMHDGRMYTLNAVLHHYTSEVQDMATL
DPLLKQNGVPGIPLSANEQQYLLAFLNTLNDRHFITDKRFSEESQ
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgattacaattaatactgatcacgggattttcacttttactactcgcctgtagt
aaaagtgatgatatcctggctttcatcggatttaaaaagccggcgcattttcctgcgcct
gtatacaagctggaaaacaatccggttacgcaggaaggttttgaattgggcaggaagctc
ttttatgagtcacggctttcccggaacaatacagtttcctgtgggttctgtcatttgcag
acagcggcatttacccatcatggacatgatgtgagtcatgggatagacgaccgcttaggt
agccgtaactcccctcccattatgaatctcgcctggaacacgacgtttatgtgggatggc
ggtgtatttgatcttgacctgcaacctatcgtaccgattacaaatccggtagaaatggat
gaaacggtagagaatgtgctgaataagttacggaatacggcgccttatccggcaatgttt
aaaaaagcgtttggtacagaagagatcaccacggccaggatgatgaaggccttgtcacag
tttatggtaatgcttgtcagcgatcagtctaaatacgacagcgtcatccgaaaacagggg
cctgtgtttacacaggaagagcaacaagggtatacgctgtttcagcagaagtgcagtagt
tgtcataaggagcccttattcacggatcagtcgttccggaacaatggtattggtactggg
ccgaacaatgatgaagggcgttattctgtgtcgctgaatgcagcagacaagtacaggttt
aaagtcccgagcctgcggaacctggcttatacagccccttacatgcatgacgggcggatg
tacacgttaaatgcggtcctgcatcattatacctcggaggtacaggacatggctacgctg
gatcctttgctgaaacaaaacggcgtgccggggattcctttatctgcaaatgaacagcaa
tacttattagcgtttctcaatacgctcaatgaccggcattttattacagacaagcgtttc
tcggaggagtcgcagtaa

DBGET integrated database retrieval system