KEGG   Chitinophaga pinensis: Cpin_4481Help
Entry
Cpin_4481         CDS       T00959                                 

Definition
magnesium chelatase
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
cpi  Chitinophaga pinensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cpin_4481
Enzymes [BR:cpi01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Cpin_4481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5572861..5573805
Genome map
AA seq 314 aa AA seqDB search
MQSFPFTAIYAQDDFKLALILCMIEPGLGGVLALGDKGTGKTTTVRGLSHLMQHSLPDFP
FVNLPIGATEDRVLGTVQLDTLINDRKIAIQAGLLATANHGILYIDEVNLLNDYLMDILL
DASASGGYHLERDAVSHWFESKFCLVGTMNPEEGELRPQLLDRFGLSVTVHTPMDRTDRM
QIVSRRLQFDADIPAFLAQYEAAEQELAERIATAREQVKQVTYDEMIQATIADACIAHKV
EGLRADILLLKAARAYAAFHHRKSVTTDDVHKVMPFVLSHRSKNYSSSQNPQQQREQQSP
RDEKEGDSIRIKMN
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcatttccttttacagccatatacgcacaggacgacttcaaactggccctcata
ctctgtatgatagaaccgggccttggaggtgtactggcactgggcgacaaaggcaccggt
aaaacgacgaccgtcaggggactcagtcacctgatgcagcatagtctgcccgacttccct
tttgtaaacctgcccataggcgctacagaagacagggtgctgggcaccgttcaactggat
accctgatcaatgacaggaagatcgctattcaggcgggactactggctaccgctaatcat
ggtatattgtatatcgacgaggtcaatctcctgaatgattacctcatggacattctgctg
gatgcttccgccagtggtggttaccacctggaaagagatgcggtgtctcactggtttgaa
agtaagttctgcctggtaggtacgatgaatccggaggaaggcgaactgcgtccgcaactg
ctggaccgcttcggactaagtgtcactgttcatacacccatggaccggaccgaccgtatg
cagatcgtgagccgtcgtttacagtttgatgccgacattcctgctttcctcgctcaatat
gaggcggctgaacaagaacttgcagaaaggatcgctactgccagggagcaggtaaaacaa
gtcacatacgacgaaatgatacaggcaaccatcgcagatgcctgtatcgcacataaagtg
gaaggcttacgggccgatattctgttgctgaaagcagcaagagcatatgcggctttccat
caccggaaatccgtcaccacagacgacgtacataaagtgatgccttttgtactctcccat
cgttcaaaaaactattcttcatcacaaaatcctcagcagcaaagagagcagcagtctccc
agggatgaaaaggagggcgattcgataaggataaaaatgaactga

DBGET integrated database retrieval system