KEGG   Chitinophaga pinensis: Cpin_4671Help
Entry
Cpin_4671         CDS       T00959                                 

Definition
magnesium protoporphyrin chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
cpi  Chitinophaga pinensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cpin_4671
Enzymes [BR:cpi01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Cpin_4671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5830454..5831953
Genome map
AA seq 499 aa AA seqDB search
MNINISTLGELKKSGYKPKSVKEEIRQNLIRKLQQKENAFPGIIGYEDTVIPDTERALLS
RHNILFLGLRGQAKTRMARQMVSLLDEYIPIVEGSEVNDSPFEPLSRHARDIVAELGDAT
PISWVHRDQRYSEKLATPDVSVADLVGDIDPIKAANMKLNYADERVIHFGIIPRSNRGIF
VINELPDLQARIQVSLFNILQEGDIQIRGFKVRMPLDILFVFTANPEDYTNRGSIVTPLK
DRIESQIITHYPKNIENSLLITEQEANVHDEQRHVHISDMIKRLIEQVAFEARNSEYVDK
KSGVSARLTIAAYENAVSAGERRAIINKEKETYVRIADLQGIIPAITGKIELVYEGEQEG
PLQVAVNLLDKAIRSVFSQYFPNPDSFKKRKQSAAGENPYRAVIQWFDKGNAVQLLQDVN
DKQYETSLQKVDGLKELIKGKFPHANNKEQLLLMEFVLHGLASYSLISKKVVENETRFSD
LLGTMMNFGSGTEEENDEF
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcaacataagtacgttaggtgaattaaagaagagtggatataaacctaaatcc
gttaaagaagagatcagacaaaacctgatccgtaaactccagcaaaaagaaaacgcattc
cccggtatcatcggctacgaagacaccgttattcctgatacggaaagagccctgctctcc
cgtcataatatcctgttcctcggtctccgcggacaggcaaaaactcgtatggcccggcag
atggtttccctgctggacgaatacattcccatcgtggaaggttctgaagtgaacgatagt
cccttcgaaccactctcccgtcacgcacgtgatatcgttgccgaactgggtgacgccacg
cctatctcatgggtacaccgtgaccagcgttacagcgaaaaactcgctacgccggatgta
tccgtagctgacctcgtcggtgatatcgacccgatcaaggctgctaacatgaaactgaac
tatgcagacgagcgtgtgatccacttcggtatcattccacgctccaacagaggcatcttc
gtgatcaacgaattgcccgacctgcaggcccgtatacaggtatccctgttcaacatcctc
caggaaggcgatatccagatccgtggttttaaagtacgtatgccactggatattctcttc
gtgttcactgcaaatccggaagactataccaatcgtggttccatcgtaacgccactcaaa
gaccgtatagaaagccagatcattacacactatccgaagaatatcgaaaactccctgctc
attaccgaacaggaagccaatgtacatgatgaacaacgccatgtacatatcagcgatatg
atcaagcgccttatcgaacaggtggcttttgaagcgcgtaacagtgagtacgttgacaaa
aagagcggtgtatctgcccgtctgaccatcgccgcttatgaaaacgcagtgagcgcaggc
gaacgcagagccatcatcaacaaggaaaaagaaacttacgtacgtatagccgacctccag
ggtattattccggccattaccggtaaaatagagctggtatatgaaggcgaacaggaaggg
ccgttacaggtggccgtaaatctcctcgacaaggccatccgcagcgtcttctcccagtac
ttcccgaacccggattccttcaaaaaacgtaaacagagcgctgctggcgagaatccttac
agggcggttatccaatggtttgataaaggcaatgccgtacagttattgcaggatgtaaat
gataagcaatacgagacatcccttcagaaggtagatggtctgaaagagctgatcaaaggg
aaattcccacatgccaataacaaagaacagttactgctcatggaattcgtattacacggc
ctcgcttcctactccctcatcagtaaaaaggtggtggaaaacgagacccgcttcagtgat
ctccttggtaccatgatgaacttcggttccggtacagaagaagaaaacgacgaattctaa

DBGET integrated database retrieval system