KEGG   Chitinophaga pinensis: Cpin_4671Help
Entry
Cpin_4671         CDS       T00959                                 

Definition
(GenBank) magnesium protoporphyrin chelatase, putative
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
cpi  Chitinophaga pinensis
Pathway
cpi00860  Porphyrin and chlorophyll metabolism
cpi01100  Metabolic pathways
cpi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cpin_4671
Enzymes [BR:cpi01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Cpin_4671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase Sigma54_activat AAA_5 AAA_3
Motif
Other DBs
NCBI-ProteinID: ACU62108
JGI: Cpin_4671
UniProt: C7PKP2
Position
5830454..5831953
Genome map
AA seq 499 aa AA seqDB search
MNINISTLGELKKSGYKPKSVKEEIRQNLIRKLQQKENAFPGIIGYEDTVIPDTERALLS
RHNILFLGLRGQAKTRMARQMVSLLDEYIPIVEGSEVNDSPFEPLSRHARDIVAELGDAT
PISWVHRDQRYSEKLATPDVSVADLVGDIDPIKAANMKLNYADERVIHFGIIPRSNRGIF
VINELPDLQARIQVSLFNILQEGDIQIRGFKVRMPLDILFVFTANPEDYTNRGSIVTPLK
DRIESQIITHYPKNIENSLLITEQEANVHDEQRHVHISDMIKRLIEQVAFEARNSEYVDK
KSGVSARLTIAAYENAVSAGERRAIINKEKETYVRIADLQGIIPAITGKIELVYEGEQEG
PLQVAVNLLDKAIRSVFSQYFPNPDSFKKRKQSAAGENPYRAVIQWFDKGNAVQLLQDVN
DKQYETSLQKVDGLKELIKGKFPHANNKEQLLLMEFVLHGLASYSLISKKVVENETRFSD
LLGTMMNFGSGTEEENDEF
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcaacataagtacgttaggtgaattaaagaagagtggatataaacctaaatcc
gttaaagaagagatcagacaaaacctgatccgtaaactccagcaaaaagaaaacgcattc
cccggtatcatcggctacgaagacaccgttattcctgatacggaaagagccctgctctcc
cgtcataatatcctgttcctcggtctccgcggacaggcaaaaactcgtatggcccggcag
atggtttccctgctggacgaatacattcccatcgtggaaggttctgaagtgaacgatagt
cccttcgaaccactctcccgtcacgcacgtgatatcgttgccgaactgggtgacgccacg
cctatctcatgggtacaccgtgaccagcgttacagcgaaaaactcgctacgccggatgta
tccgtagctgacctcgtcggtgatatcgacccgatcaaggctgctaacatgaaactgaac
tatgcagacgagcgtgtgatccacttcggtatcattccacgctccaacagaggcatcttc
gtgatcaacgaattgcccgacctgcaggcccgtatacaggtatccctgttcaacatcctc
caggaaggcgatatccagatccgtggttttaaagtacgtatgccactggatattctcttc
gtgttcactgcaaatccggaagactataccaatcgtggttccatcgtaacgccactcaaa
gaccgtatagaaagccagatcattacacactatccgaagaatatcgaaaactccctgctc
attaccgaacaggaagccaatgtacatgatgaacaacgccatgtacatatcagcgatatg
atcaagcgccttatcgaacaggtggcttttgaagcgcgtaacagtgagtacgttgacaaa
aagagcggtgtatctgcccgtctgaccatcgccgcttatgaaaacgcagtgagcgcaggc
gaacgcagagccatcatcaacaaggaaaaagaaacttacgtacgtatagccgacctccag
ggtattattccggccattaccggtaaaatagagctggtatatgaaggcgaacaggaaggg
ccgttacaggtggccgtaaatctcctcgacaaggccatccgcagcgtcttctcccagtac
ttcccgaacccggattccttcaaaaaacgtaaacagagcgctgctggcgagaatccttac
agggcggttatccaatggtttgataaaggcaatgccgtacagttattgcaggatgtaaat
gataagcaatacgagacatcccttcagaaggtagatggtctgaaagagctgatcaaaggg
aaattcccacatgccaataacaaagaacagttactgctcatggaattcgtattacacggc
ctcgcttcctactccctcatcagtaaaaaggtggtggaaaacgagacccgcttcagtgat
ctccttggtaccatgatgaacttcggttccggtacagaagaagaaaacgacgaattctaa

DBGET integrated database retrieval system