KEGG   Chitinophaga pinensis: Cpin_4694Help
Entry
Cpin_4694         CDS       T00959                                 

Definition
(GenBank) diaminopimelate epimerase
  KO
K01778  diaminopimelate epimerase [EC:5.1.1.7]
Organism
cpi  Chitinophaga pinensis
Pathway
cpi00300  Lysine biosynthesis
cpi01100  Metabolic pathways
cpi01110  Biosynthesis of secondary metabolites
cpi01120  Microbial metabolism in diverse environments
cpi01130  Biosynthesis of antibiotics
cpi01230  Biosynthesis of amino acids
Module
cpi_M00527  Lysine biosynthesis, DAP aminotransferase pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Cpin_4694
Enzymes [BR:cpi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.7  diaminopimelate epimerase
     Cpin_4694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAP_epimerase
Motif
Other DBs
NCBI-ProteinID: ACU62131
JGI: Cpin_4694
UniProt: C7PKR5
Position
5853326..5854111
Genome map
AA seq 261 aa AA seqDB search
MSAIHFYKYQGTGNDFVIMDNRNGEYNFLTEEQVHFLCDRRFGIGADGLMLLNKQEGYDF
GMKYYNADGRESSMCGNGGRCLVAFARKMGLTDEKLSFLAVDGPHEATLKGDDWVNLKMQ
DVSGVEINSLHSYLNTGSPHYVKFVADVKAVDVYNEGKQIRYNDRFAKEGTNVNFVQSLD
KGIFVRTYERGVEDETYSCGTGVTAAALMTAGAETKEYIVPVQTLGGKLEVRFTRIGEKA
YNNIWLCGPATLVFEGNITLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcaatacatttttacaaataccagggtaccggcaatgatttcgtgatcatggac
aaccggaacggagaatacaattttcttacagaagaacaggtgcactttctttgtgacaga
cgtttcggtatcggagcggatggtttgatgctgctgaataaacaggaaggatatgacttc
ggtatgaagtattacaatgccgatggtcgtgaaagcagcatgtgtggtaatggtggccgt
tgcctggtagcttttgcccgtaaaatgggactgacagacgaaaaactgagcttcctcgca
gtggatggtccacatgaagcgaccttaaaaggcgatgattgggtgaacctgaaaatgcag
gacgtgagcggtgttgagatcaattcccttcattcttacctgaataccggttctccacat
tatgtgaaatttgtagcagatgtgaaagcggtagatgtatacaacgaaggtaaacagatc
cgctacaacgaccgctttgccaaagaaggcactaacgtaaactttgtacaatcgctcgat
aaaggcatcttcgtacgtacctatgaacgcggtgtcgaagacgaaacctactcctgtggt
acaggcgtaacagcagcagcactgatgactgccggtgcagaaacaaaagaatacatcgta
cctgtacagacgctgggcggtaaactggaagtacgctttacccgcatcggtgaaaaagcc
tacaacaatatctggctttgcggacccgctacccttgtattcgagggaaatatcacattg
ccataa

DBGET integrated database retrieval system