KEGG   Chitinophaga pinensis: Cpin_4694Help
Entry
Cpin_4694         CDS       T00959                                 

Definition
(GenBank) diaminopimelate epimerase (EC:5.1.1.7)
  KO
K01778  
diaminopimelate epimerase [EC:5.1.1.7]
Organism
cpi  Chitinophaga pinensis
Pathway
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Lysine biosynthesis, DAP aminotransferase pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cpin_4694
  Amino acid metabolism
   00300 Lysine biosynthesis
    Cpin_4694
Enzymes [BR:cpi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.7  diaminopimelate epimerase
     Cpin_4694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
5853326..5854111
Genome map
AA seq 261 aa AA seqDB search
MSAIHFYKYQGTGNDFVIMDNRNGEYNFLTEEQVHFLCDRRFGIGADGLMLLNKQEGYDF
GMKYYNADGRESSMCGNGGRCLVAFARKMGLTDEKLSFLAVDGPHEATLKGDDWVNLKMQ
DVSGVEINSLHSYLNTGSPHYVKFVADVKAVDVYNEGKQIRYNDRFAKEGTNVNFVQSLD
KGIFVRTYERGVEDETYSCGTGVTAAALMTAGAETKEYIVPVQTLGGKLEVRFTRIGEKA
YNNIWLCGPATLVFEGNITLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcaatacatttttacaaataccagggtaccggcaatgatttcgtgatcatggac
aaccggaacggagaatacaattttcttacagaagaacaggtgcactttctttgtgacaga
cgtttcggtatcggagcggatggtttgatgctgctgaataaacaggaaggatatgacttc
ggtatgaagtattacaatgccgatggtcgtgaaagcagcatgtgtggtaatggtggccgt
tgcctggtagcttttgcccgtaaaatgggactgacagacgaaaaactgagcttcctcgca
gtggatggtccacatgaagcgaccttaaaaggcgatgattgggtgaacctgaaaatgcag
gacgtgagcggtgttgagatcaattcccttcattcttacctgaataccggttctccacat
tatgtgaaatttgtagcagatgtgaaagcggtagatgtatacaacgaaggtaaacagatc
cgctacaacgaccgctttgccaaagaaggcactaacgtaaactttgtacaatcgctcgat
aaaggcatcttcgtacgtacctatgaacgcggtgtcgaagacgaaacctactcctgtggt
acaggcgtaacagcagcagcactgatgactgccggtgcagaaacaaaagaatacatcgta
cctgtacagacgctgggcggtaaactggaagtacgctttacccgcatcggtgaaaaagcc
tacaacaatatctggctttgcggacccgctacccttgtattcgagggaaatatcacattg
ccataa

DBGET integrated database retrieval system