KEGG   Chitinophaga pinensis: Cpin_4694Help
Entry
Cpin_4694         CDS       T00959                                 

Definition
diaminopimelate epimerase
Orthology
K01778  
diaminopimelate epimerase [EC:5.1.1.7]
Organism
cpi  Chitinophaga pinensis
Pathway
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cpi01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cpi00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5853326..5854111
Genome map
AA seq 261 aa AA seqDB search
MSAIHFYKYQGTGNDFVIMDNRNGEYNFLTEEQVHFLCDRRFGIGADGLMLLNKQEGYDF
GMKYYNADGRESSMCGNGGRCLVAFARKMGLTDEKLSFLAVDGPHEATLKGDDWVNLKMQ
DVSGVEINSLHSYLNTGSPHYVKFVADVKAVDVYNEGKQIRYNDRFAKEGTNVNFVQSLD
KGIFVRTYERGVEDETYSCGTGVTAAALMTAGAETKEYIVPVQTLGGKLEVRFTRIGEKA
YNNIWLCGPATLVFEGNITLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcaatacatttttacaaataccagggtaccggcaatgatttcgtgatcatggac
aaccggaacggagaatacaattttcttacagaagaacaggtgcactttctttgtgacaga
cgtttcggtatcggagcggatggtttgatgctgctgaataaacaggaaggatatgacttc
ggtatgaagtattacaatgccgatggtcgtgaaagcagcatgtgtggtaatggtggccgt
tgcctggtagcttttgcccgtaaaatgggactgacagacgaaaaactgagcttcctcgca
gtggatggtccacatgaagcgaccttaaaaggcgatgattgggtgaacctgaaaatgcag
gacgtgagcggtgttgagatcaattcccttcattcttacctgaataccggttctccacat
tatgtgaaatttgtagcagatgtgaaagcggtagatgtatacaacgaaggtaaacagatc
cgctacaacgaccgctttgccaaagaaggcactaacgtaaactttgtacaatcgctcgat
aaaggcatcttcgtacgtacctatgaacgcggtgtcgaagacgaaacctactcctgtggt
acaggcgtaacagcagcagcactgatgactgccggtgcagaaacaaaagaatacatcgta
cctgtacagacgctgggcggtaaactggaagtacgctttacccgcatcggtgaaaaagcc
tacaacaatatctggctttgcggacccgctacccttgtattcgagggaaatatcacattg
ccataa

DBGET integrated database retrieval system