KEGG   Chitinophaga pinensis: Cpin_5260Help
Entry
Cpin_5260         CDS       T00959                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
cpi  Chitinophaga pinensis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Cpin_5260
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Cpin_5260
Enzymes [BR:cpi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Cpin_5260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6658435..6660264)
Genome map
AA seq 609 aa AA seqDB search
MLKRIASILVFSLGVSGAHAQSNYSIIPKPVSVQAATGHFALGKQTVLVAASDAARKNAD
LFNEFLWNRYGIKLTIAREASGKAIVLDDQADAGAQEAYSLTVTPEKITIKGGSAGCFYG
LQSVLQLIETQDGGLSVPAVTVSDKPEFGYRGVMIDVARHFFSLDEMKKIVDLLAYFKFN
RLHWHLTDDQGWRLEIKKYPKLTQVSAWRDSSILRQYGDYKPFVYDGVKHGGYYSQEEAR
ELVKYAADRKITILPEIELPGHSTAVLAAYPQFGCKDTLYHVPGYWGVHYAIYCPKEETF
KFLEDVLTEVMAIFPGEYIHVGGDEVPKEHWQESKFAQTLIAKQKLKDEHELQSYFISRI
EKFLNKNGRRLVGWDEILEGGLAPNATVMSWRGEKGGIAAARMGHDVIMTPNSHLYIDHY
QSKDKQNEPTAIGGFLPLERVYSYNPRPDSLTPDQQQHVLGVQANLWTEYIGTNNKLEYM
LFPRMLALSEVAWSAKGQRNYEDFSTARLPLRLQELEQMKVYYRIPEAKVTFGADAAGRR
TAEIIPFVANSNVYYTVDGHKADQTANLYNGAILLPVKGKSEKPMVLNYIIVTPGGRVSN
MFTVPLEGN
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaagaattgcatctattttagtcttttctctgggagtgagtggcgctcatgca
caaagcaactactccatcatcccgaaacctgtttctgtacaggctgcgaccggacatttt
gcattaggtaaacagaccgtactggtggcagcaagcgatgccgcaagaaagaatgcggat
ctgttcaatgaatttctctggaaccgttatggtatcaaactgaccatcgcccgtgaggcc
agcgggaaggcgatcgtactggacgaccaggcagatgccggcgcgcaggaggcttatagt
ctgactgtgacacctgagaaaatcaccatcaagggtggcagcgcaggttgtttttatggg
ctgcaatcggtattgcagctgatcgaaacacaagacggcggactcagtgtaccggcagtt
actgttagtgacaaaccggaatttggttaccgtggtgtgatgatcgacgtagcaagacat
ttcttctccctggatgaaatgaagaagatcgtggatctcctggcttattttaaattcaac
agactgcattggcacctgaccgatgaccagggctggagactggagatcaaaaagtacccg
aaactgacccaggtatccgcctggcgtgattccagtattctgagacagtatggcgattat
aaaccattcgtgtatgacggcgtgaaacacggcggttattattcacaggaagaggcgcgt
gagctggtgaaatatgctgctgaccgtaagatcacgattctgccggagatcgaattgcca
ggccacagtactgcggtattggctgcttatccgcagtttggttgtaaagataccctgtat
catgtgccaggttactggggcgtacattatgcgatctattgtccgaaggaagagactttt
aaattcctggaggatgtgctgactgaagtcatggcgatcttcccgggtgagtacatccat
gtaggtggcgacgaagtaccgaaggagcactggcaggagtctaaatttgcacagaccctg
attgcgaaacagaagctgaaagacgagcatgagttacagagctattttatttcccgtatc
gagaagttcctgaataagaatggcagacgcctggtaggatgggacgagatcctggaaggt
ggattagcgcctaatgcgactgtcatgagctggagaggggagaaaggcggtatcgcagct
gcgagaatgggccatgatgtgattatgacgcctaacagccacttgtatatcgaccattat
cagtctaaagataaacagaatgagccgacggctattggcggtttcctgccgttagagaga
gtgtacagctacaatccacgtcctgattcgctgacgcccgatcagcagcagcatgtactg
ggtgtacaggcaaacctctggacagagtatatcggtaccaataataaactggaatatatg
ctgttcccgcgtatgctggcattgtcagaggtggcatggtcagcgaaggggcagcggaat
tatgaggacttctctactgcgcgtctgcctttacgtttgcaggagctggagcagatgaag
gtgtactatcgtattccggaggcaaaggtgacttttggcgcagatgcagctggcaggaga
actgcggagattattccttttgtagcgaacagcaacgtgtattatactgttgacgggcat
aaggcagatcagactgctaacctgtacaacggggcgatattgctgccggtgaaagggaaa
agtgagaagccgatggtgttgaattatattattgtaacaccaggaggtagagtgagtaat
atgtttacggtgccgctggaggggaattag

DBGET integrated database retrieval system