KEGG   Chitinophaga pinensis: Cpin_5431Help
Entry
Cpin_5431         CDS       T00959                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cpi  Chitinophaga pinensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cpin_5431
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cpin_5431
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cpin_5431
Enzymes [BR:cpi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cpin_5431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6942115..6943422
Genome map
AA seq 435 aa AA seqDB search
MKYFSLQNKQHVVSFEEAVVQGLAPDKGLYFPERIPAFEQAFLNDIVHKNDLDIAYAAIQ
PFVGEEIPEATLRQIIADTLSFPFPVEKVEGNVYSLELFHGPTLAFKDVGARFMAGCLGY
FRRNDSRPVTVLVATSGDTGGAVANGFYNVPGVRVVILYPSGKVSTLQEKQLTTLNGNIT
ALEIDGTFDDCQRMVKTAFLDEALQSHVMLTSANSINVARWLPQMFYYLLAYKQLSAAYP
DIVFSVPSGNFGNICAGMMAAAMGLPVKHFVASTNVNDTVPRFMQTGAYTPGKATATLSN
AMDVADPSNFVRILELFANSLPALKEKLTSISFNDKDTAATMEQVWKDYQYMLDPHGAVG
YLGLKQYLQTTGPDTKTAGVFLETAHPVKFADTAPASLQDKIVTPDRVQSLYDLEKQSIQ
LPAEYNALKQWLMAN
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatttcagtctacagaataaacaacacgttgtatcttttgaagaagccgtagta
cagggtctcgcacccgataaaggattatacttccccgagcgtattccggcttttgagcaa
gcattcctcaatgatatcgttcataaaaacgacctcgatattgcttacgcagcgatacag
ccatttgtaggagaagaaattcccgaagctacattaaggcagatcattgcggatacgctt
agttttcctttcccggtggagaaagtagaagggaatgtatattccctggaactcttccat
ggtcctaccctggcatttaaggacgtcggcgcacgctttatggcgggttgcctgggttat
ttcagaagaaatgatagccgtccggtaactgtactcgtagctacttccggtgataccggc
ggtgctgttgccaacggtttctataatgtgcccggcgtacgtgtagtgatcctttaccct
tccggcaaagtgagcaccttacaggaaaaacagctgaccacactcaatggcaacattaca
gcgcttgaaatagacggtacttttgatgattgtcagcggatggtgaaaacggcttttctg
gatgaagctttgcagtcacacgtaatgctgaccagcgctaactctatcaacgtcgcacgc
tggctgccgcagatgttctattatctgctggcatacaaacagcttagcgctgcctatcct
gatatcgtattctctgtaccaagcggcaactttggtaatatctgtgcaggcatgatggcg
gcagcgatggggcttccggtaaaacatttcgtggccagtaccaatgtgaatgatacggtg
ccaagattcatgcagacaggcgcgtatacgccaggtaaagcgacagctacactgtctaat
gcgatggacgtggctgatccgagcaactttgtacgtatccttgaattatttgcgaatagt
ttgccggctctgaaagagaaactgacatctatttccttcaacgataaagataccgcggct
acgatggaacaggtctggaaagactaccagtatatgctggatcctcatggcgcggtaggc
tatctcggcctgaaacagtatttgcagacgactggtccggatacaaaaactgccggtgta
tttctggagacagcgcatccggttaaattcgcagatactgctccggcgtctctgcaggat
aagatcgtaacgcctgacagggtacagtccctgtatgacctggagaaacaatccatacaa
ctcccggctgagtataatgcattaaaacaatggctcatggccaattga

DBGET integrated database retrieval system