KEGG   Chitinophaga pinensis: Cpin_5465Help
Entry
Cpin_5465         CDS       T00959                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cpi  Chitinophaga pinensis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cpi00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6974814..6975674
Genome map
AA seq 286 aa AA seqDB search
MDTMEGKNGEYTTINCQGTLLDLSKPVVMGIINITEDSFFAGSRTQHIDLILQRAAQLLK
EGAQILDIGAQSTRPGSVSVGPDIELERLLPAVRTLKEHFPQAILSIDTYYANVAEQTVN
AGAAIINDISAGDLDAEMIPTAGRLGVPYIAMHMQGTPTDMQQHPHYEDVTLEVLDYFVR
KRAQCLEAGIKDIIIDPGFGFGKTIAHNYTLLKKLNVFHMLECPLLVGISRKSMIYKLLE
TTPAEALNGTTILHTLALQQGAHILRVHDVKAAVEAVKITQYMNRL
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggatactatggaagggaagaacggcgaatataccaccatcaactgtcagggcactttg
ctggatttgtccaaaccagtggtgatgggtatcatcaacatcacggaagactcatttttt
gccggcagcagaacgcagcatattgatcttatcctgcaaagagcagcacaactattgaaa
gaaggcgctcagatcctggatatcggggcacagagtacccgtccgggttctgtctccgtc
ggacccgatattgaactggaacgcctgctaccggcagtacgtacattgaaagaacatttt
ccacaggccatcctgtccatcgacacttactatgcgaatgtagctgaacagactgtcaat
gcgggcgcagccatcattaatgatatcagtgcaggtgatctggatgcggaaatgatacct
accgccggcagactgggagtaccatatatcgccatgcacatgcagggtacgcctactgat
atgcagcaacacccgcattatgaagatgtgacactggaagtactggattatttcgtacgc
aaacgcgcacaatgtctggaagctggtatcaaagatattatcatcgatccgggtttcggt
tttggtaaaaccattgcacacaattatacactactcaaaaaactcaatgtttttcatatg
ctggaatgcccgctgctggtaggtatttcaaggaaatccatgatctataaactattggag
accacacctgcggaagcactgaatggtacaacgatactgcatacacttgcgttgcagcag
ggagcgcatatcctgcgtgtacacgacgtcaaagccgccgtggaagcggttaaaatcaca
cagtatatgaataggttatag

DBGET integrated database retrieval system