KEGG   Chitinophaga pinensis: Cpin_5842Help
Entry
Cpin_5842         CDS       T00959                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cpi  Chitinophaga pinensis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cpi00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7423662..7424153
Genome map
AA seq 163 aa AA seqDB search
MNKAILLIGGNLGDRTGHLREAVEQIDKQVGRVEKQSSLYETAAWGVAGQPDYLNQALLV
STEMDARTLLNTVLAIEHNIGRVRRQKWGARVIDIDVIFFNDAVINEPDLKIPHPQMQFR
QFVLVPLMEILPDWEHPVLHQSVSTLLANCTDQLPASKYTGIS
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagcaatattacttataggtggcaatctgggagaccgtacagggcacctccgg
gaggctgtggagcaaatagacaaacaggtcggaagggtcgaaaagcagtcctctctttat
gaaacggctgcctggggcgtagccggacaaccagattacctgaatcaggcccttttggtt
tctactgaaatggatgcacgaaccctcctgaacaccgtgctggccatagaacataacata
ggccgcgtacgccggcagaaatggggtgcaagggtaattgacattgacgtcattttcttt
aatgatgccgtcatcaatgaaccggatctcaaaatccctcatccacagatgcagttcaga
cagtttgtactggtaccgctcatggaaatccttcccgactgggaacatcccgtgctgcat
cagtccgtcagcaccttactggccaactgcaccgatcaactacctgccagtaaatacacc
ggcatatcctaa

DBGET integrated database retrieval system