KEGG   Chitinophaga pinensis: Cpin_5913Help
Entry
Cpin_5913         CDS       T00959                                 

Definition
glycoside hydrolase
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
cpi  Chitinophaga pinensis
Brite
Enzymes [BR:cpi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Cpin_5913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(7505745..7506242)
Genome map
AA seq 165 aa AA seqDB search
MELGANGEKLIKHFEKCRLAAYQDSKGIWTIGWGNTVYEDGKAVKKGDTITQQRADALFT
NIKKGFVADVNKLTTGIKGLKQQQFDALVCFAYNVGSDMNKNGIAEGLGDSTLLKVVKAD
PKDPSVVMEFLKWNMSGGKVLDGLTRRRKAEAYLYMSGEVEFFDY
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atggaattaggcgcaaacggggaaaagctcattaaacacttcgagaaatgccgtctggca
gcataccaggacagcaaaggcatctggacaatcggttggggtaataccgtatacgaagac
ggtaaagcagtaaaaaagggagatactattacgcagcaacgtgcggatgcactgttcacc
aatattaaaaaaggcttcgtagcagatgtaaataagctcactacaggtataaaaggtctg
aaacaacagcagtttgacgcgctggtatgtttcgcttacaacgtaggtagcgatatgaac
aaaaacggtattgcggaaggtctgggtgatagcactctgctgaaagtagtgaaagctgat
cctaaggatccttctgtcgtgatggagtttctgaaatggaatatgtcaggaggtaaagtg
ttggatggtctgacccgcagacgtaaagcagaagcttacctctacatgagcggagaagtt
gagttcttcgattattga

DBGET integrated database retrieval system