KEGG   Chitinophaga pinensis: Cpin_6209Help
Entry
Cpin_6209         CDS       T00959                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cpi  Chitinophaga pinensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cpin_6209
   01230 Biosynthesis of amino acids
    Cpin_6209
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cpin_6209
   00051 Fructose and mannose metabolism
    Cpin_6209
   00562 Inositol phosphate metabolism
    Cpin_6209
Enzymes [BR:cpi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Cpin_6209
Exosome [BR:cpi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Cpin_6209
  Exosomal proteins of bladder cancer cells
   Cpin_6209
  Exosomal proteins of melanoma cells
   Cpin_6209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(7833286..7834014)
Genome map
AA seq 242 aa AA seqDB search
MNLTIGQAEQLINDILQAGLRLKEGQEVVVATPFPYLLKAKALLKNTPGFYVAAQNCASE
KSGAYTGEVSAEMLASIGVDYVILGHSERREYFQESNAVLAKKIDLALANGIKPIFCCGE
PLEVRKAETQNEYVAKQLEESLYHLTEEQLKDVVIAYEPIWAIGTGLTASAAQAQDMHAF
IRGQIAAKYGREAALRLTIQYGGSAKPSNAGELFACPDVDGGLIGGASLVAADFLAIVSH
LG
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgaccatcggacaggcagaacagctgatcaatgacattttgcaggctggcctg
cgtttgaaggaaggacaggaagtggtagtcgccaccccttttccatacctgttgaaagca
aaggcattattgaaaaatacgcctggtttttatgtggcagctcagaactgtgcatctgag
aaatctggtgcatatactggtgaggtatctgcagaaatgctggcttctattggtgttgac
tatgtaatactgggtcactctgagagaagggaatatttccaggaaagcaatgctgtactg
gcaaagaaaattgatctggcgctggcaaacggcatcaaaccaatcttctgttgcggtgaa
ccactggaagtaaggaaagctgaaacacagaacgaatatgttgcaaaacagctggaagag
agcctgtatcacctgactgaagagcagctgaaagatgtcgttatcgcttatgagccaatc
tgggcaatcggtactggtctgacagcgagcgctgcgcaggcccaggatatgcacgctttc
atcagaggacagatcgctgctaaatatggcagagaagcggctttacgcctgactatccag
tatggtggtagtgcaaaaccttctaatgcaggtgaactgtttgcttgtcctgatgtggat
ggtggtctgatcggcggtgcttcattggtagctgctgatttcctggctatcgttagtcat
ctgggataa

DBGET integrated database retrieval system