KEGG   Chitinophaga pinensis: Cpin_6252Help
Entry
Cpin_6252         CDS       T00959                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cpi  Chitinophaga pinensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cpin_6252
Enzymes [BR:cpi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Cpin_6252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7878142..7879254
Genome map
AA seq 370 aa AA seqDB search
MLKIYKLPIITLIVSLLTIPSSAVFAQTQRMPEGFDIHKGVNISHWLSQSGGRNGVAQNE
YFTEKDVALLASKGFDHIRIPVEEAELWDYKEEKYKDAFVLLHKAIGWCKQYHIRAIVDM
HILRSHHFDGKKNRLWEESASQERFLQCWRELSGELKKYPTDLVAYELLNEPVADSASQW
NDLLARGVGLIRELEPKRVIIVGSNRYQSYATFPLLKIPANDKRIILSFHYYNPFFFTHY
KASWTAHKDFSGPVHYPGATISQKEMAQQPATIRNILAGATEEYNADVIEQQIMTAVKVA
QKLKLPLYCGEFGCLSSVYRKDRLHWYKDVKKALDKNNISWSVWDYKGSFGIIQDNGEED
DKLIKLLTRD
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagatctacaaactgcctattatcacattgatcgtgagtctgctgactattccc
tcgtcagcggtgtttgcacagacccaacgaatgcctgaaggatttgatatccataaggga
gtgaacatcagtcactggttatcgcagtccggtggccgtaatggagtagcccagaacgag
tatttcacagaaaaagacgtggccctgctggcatccaaagggtttgaccatatccgcatc
cccgtagaagaagcggaattatgggactacaaagaagaaaaatacaaagacgcattcgtc
ctgctgcacaaagcaataggatggtgtaaacaataccatatacgggcgattgtagacatg
cacatccttcgtagccatcattttgatggtaaaaagaaccgcctctgggaggaatctgct
tcacaggaacgtttcctgcaatgctggagagaactgagtggagaactgaagaaatacccg
actgacctggtagcttatgaattactgaatgagccggtagctgacagcgcatcccaatgg
aatgatctgttggctcgtggtgttgggctgatcagggaactagagcccaaacgcgtgatc
attgtaggtagtaaccgctatcagtcttacgcgacttttccgctgctgaagataccggca
aatgataagcggatcatcctgagcttccattactacaatccattcttctttacacattac
aaagccagctggacagcccacaaggatttcagcggtcccgtacactatcccggtgcgact
atctcccagaaggagatggcccagcaaccggctaccatccgcaatatactggccggcgcc
accgaagagtataatgcagacgtcatcgaacaacagatcatgaccgccgttaaagtggca
cagaaactgaagttacccctgtattgcggggagtttggctgtctgagcagcgtataccgt
aaagaccggttacattggtacaaagacgtaaagaaagcactggataaaaacaatatctcc
tggagtgtctgggattacaagggcagctttggtataatacaggacaatggtgaagaagat
gataagctgattaagctgctgaccagagattaa

DBGET integrated database retrieval system