KEGG   Chitinophaga pinensis: Cpin_6292Help
Entry
Cpin_6292         CDS       T00959                                 

Definition
(GenBank) Arginase/agmatinase/formiminoglutamase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
cpi  Chitinophaga pinensis
Pathway
cpi00220  Arginine biosynthesis
cpi00330  Arginine and proline metabolism
cpi01100  Metabolic pathways
cpi01110  Biosynthesis of secondary metabolites
cpi01130  Biosynthesis of antibiotics
cpi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Cpin_6292
   00330 Arginine and proline metabolism
    Cpin_6292
Enzymes [BR:cpi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Cpin_6292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase ChW
Motif
Other DBs
NCBI-ProteinID: ACU63697
JGI: Cpin_6292
UniProt: C7PID5
Position
7926091..7927038
Genome map
AA seq 315 aa AA seqDB search
MKNIKIIEVKSEIGAGTRGASLGVEAIKIAALDFMSNFFVHFPTEAIETENKLLFEPIES
PYAKRIKGTLTLYERISKSICETVKTNWFPVVLSGDHSTAGATIAGLKMARPKAKLGAIW
IDAHADLHTPYTTPSGNMHGMPVAISIAEDNLECKVHDVDANTIKTWDALKNLGGIAPKI
LPEDIVFISLRDYEKEEEHLIKSYGMKVISTNEVRRKGPEQVARSVFRYLSDCEYIYVSF
DVDSLDSSISKGTGTPVTNGLREREVEDLISKFMQHRKVCCFEITEVNPTLDKENLMAEI
AFNILQRSVNVLLLN
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatcaagatcattgaggtgaaatcggagattggggctggtacccgcggggcc
agtctgggagtagaagccatcaaaatagctgccctggattttatgagcaacttctttgtg
cacttccctaccgaagccatagagacagaaaacaagctgctgtttgaaccgattgaatct
ccctatgccaaacgtatcaaaggtaccctgaccttatatgaaaggatcagtaagagcatt
tgcgagacggtaaaaacaaactggtttcccgttgtattgtcgggtgaccacagtactgcc
ggggcgactatcgccggactgaaaatggcccgtccgaaagccaaactgggtgctatctgg
atcgatgcccacgccgacctgcacaccccttatacaacgccttccggtaatatgcacggt
atgcctgtcgccatctccatcgcggaggacaacctggagtgtaaagtccatgatgtagat
gccaataccatcaaaacctgggatgcacttaaaaatcttggcggaatcgcccctaagatc
ttacctgaagatattgtcttcatctccctgagagattacgaaaaagaagaagagcacctg
atcaagtcatacggcatgaaagtcatctctaccaatgaggtacgccgtaaaggtcctgaa
caggtggcccgttccgtcttccgttatctcagcgactgtgaatacatttatgtttctttt
gatgtggatagcctggattcttctatatccaaaggaaccggtaccccggtgaccaacggc
ctgcgggaacgtgaagtggaagatctgatctcaaaattcatgcagcaccggaaagtctgc
tgttttgagattacagaggtaaatcctacgcttgataaagagaacttaatggcggaaatc
gcctttaacatactacagcgcagcgtcaacgtactattattgaattaa

DBGET integrated database retrieval system