KEGG   Chitinophaga pinensis: Cpin_6292Help
Entry
Cpin_6292         CDS       T00959                                 

Definition
arginase/agmatinase/formiminoglutamase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
cpi  Chitinophaga pinensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cpi01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cpi00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7926091..7927038
Genome map
AA seq 315 aa AA seqDB search
MKNIKIIEVKSEIGAGTRGASLGVEAIKIAALDFMSNFFVHFPTEAIETENKLLFEPIES
PYAKRIKGTLTLYERISKSICETVKTNWFPVVLSGDHSTAGATIAGLKMARPKAKLGAIW
IDAHADLHTPYTTPSGNMHGMPVAISIAEDNLECKVHDVDANTIKTWDALKNLGGIAPKI
LPEDIVFISLRDYEKEEEHLIKSYGMKVISTNEVRRKGPEQVARSVFRYLSDCEYIYVSF
DVDSLDSSISKGTGTPVTNGLREREVEDLISKFMQHRKVCCFEITEVNPTLDKENLMAEI
AFNILQRSVNVLLLN
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatcaagatcattgaggtgaaatcggagattggggctggtacccgcggggcc
agtctgggagtagaagccatcaaaatagctgccctggattttatgagcaacttctttgtg
cacttccctaccgaagccatagagacagaaaacaagctgctgtttgaaccgattgaatct
ccctatgccaaacgtatcaaaggtaccctgaccttatatgaaaggatcagtaagagcatt
tgcgagacggtaaaaacaaactggtttcccgttgtattgtcgggtgaccacagtactgcc
ggggcgactatcgccggactgaaaatggcccgtccgaaagccaaactgggtgctatctgg
atcgatgcccacgccgacctgcacaccccttatacaacgccttccggtaatatgcacggt
atgcctgtcgccatctccatcgcggaggacaacctggagtgtaaagtccatgatgtagat
gccaataccatcaaaacctgggatgcacttaaaaatcttggcggaatcgcccctaagatc
ttacctgaagatattgtcttcatctccctgagagattacgaaaaagaagaagagcacctg
atcaagtcatacggcatgaaagtcatctctaccaatgaggtacgccgtaaaggtcctgaa
caggtggcccgttccgtcttccgttatctcagcgactgtgaatacatttatgtttctttt
gatgtggatagcctggattcttctatatccaaaggaaccggtaccccggtgaccaacggc
ctgcgggaacgtgaagtggaagatctgatctcaaaattcatgcagcaccggaaagtctgc
tgttttgagattacagaggtaaatcctacgcttgataaagagaacttaatggcggaaatc
gcctttaacatactacagcgcagcgtcaacgtactattattgaattaa

DBGET integrated database retrieval system