KEGG   Chitinophaga pinensis: Cpin_6304Help
Entry
Cpin_6304         CDS       T00959                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cpi  Chitinophaga pinensis
Pathway
cpi00071  Fatty acid degradation
cpi00280  Valine, leucine and isoleucine degradation
cpi00281  Geraniol degradation
cpi00310  Lysine degradation
cpi00360  Phenylalanine metabolism
cpi00362  Benzoate degradation
cpi00380  Tryptophan metabolism
cpi00410  beta-Alanine metabolism
cpi00627  Aminobenzoate degradation
cpi00640  Propanoate metabolism
cpi00650  Butanoate metabolism
cpi00903  Limonene and pinene degradation
cpi00930  Caprolactam degradation
cpi01100  Metabolic pathways
cpi01110  Biosynthesis of secondary metabolites
cpi01120  Microbial metabolism in diverse environments
cpi01130  Biosynthesis of antibiotics
cpi01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Cpin_6304
   00650 Butanoate metabolism
    Cpin_6304
  Lipid metabolism
   00071 Fatty acid degradation
    Cpin_6304
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Cpin_6304
   00310 Lysine degradation
    Cpin_6304
   00360 Phenylalanine metabolism
    Cpin_6304
   00380 Tryptophan metabolism
    Cpin_6304
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Cpin_6304
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Cpin_6304
   00281 Geraniol degradation
    Cpin_6304
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Cpin_6304
   00627 Aminobenzoate degradation
    Cpin_6304
   00930 Caprolactam degradation
    Cpin_6304
Enzymes [BR:cpi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Cpin_6304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: ACU63709
JGI: Cpin_6304
UniProt: C7PIE7
Position
complement(7943978..7944757)
Genome map
AA seq 259 aa AA seqDB search
MQPQFIIIHRQVAPYVAHIQLNRPKELNALNLELMIELRDALKMLDADDNVRAIVISGNE
KAFAAGADIKQMAGKTAMDMYNIDQFSTWDTIKKTKKPLIAAVSGFALGGGCELVMLCDM
IVASETARFGQPEIKIGVMPGAGGTQRLTRAVGKALAMEMVLTGRFITAQEAARAGLINR
VIPVELFLQEAIRLATEVAALSPLAVKMAKESVLKAFDSSLEEGLHFERKNFYLLFASED
QKEGMQAFVDKRSPVFKGK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccacaatttataatcatacaccggcaggtagccccatatgtggctcatatacag
ttaaaccgccccaaagaactcaatgcactgaaccttgaactgatgattgagctcagggat
gcattaaaaatgttggatgcggatgacaatgttcgtgcaatcgtcatcagcggtaatgaa
aaagcattcgctgcaggcgcggatatcaaacagatggcggggaaaactgccatggacatg
tataacattgaccagttcagcacctgggacacaataaaaaaaactaaaaagccgttgatt
gcggcagtaagcggcttcgcgctgggagggggatgtgagctggtgatgctatgcgatatg
atagtagccagtgaaacagcgcggttcggacagccggaaataaaaattggcgtcatgcct
ggcgcaggtggtacacaacgcctgacccgcgccgtaggtaaagccctggccatggaaatg
gtattgacaggtcgctttatcactgcacaagaagctgcacgtgcaggtcttatcaaccgg
gtaataccggtggaacttttcctgcaggaagccatccggctggcgactgaagtagctgcg
cttagtccgttggcagtaaagatggctaaagaatctgtactgaaagcatttgatagctcc
ctcgaagaaggactacattttgaacgtaaaaacttttatctgctgtttgcctctgaagat
cagaaagaaggcatgcaggcttttgttgataagagatcacctgtttttaaaggaaaataa

DBGET integrated database retrieval system