KEGG   Chitinophaga pinensis: Cpin_6387Help
Entry
Cpin_6387         CDS       T00959                                 

Definition
phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
cpi  Chitinophaga pinensis
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Cpin_6387
Enzymes [BR:cpi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Cpin_6387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8027760..8030123
Genome map
AA seq 787 aa AA seqDB search
MATLTNEQVHNIQAYWEASNYLAAAQIYLQDNPLLKDPLLTGHIKPRLLGHWGTSPGLNF
IYVHLNRLIKSSDADILFICGPGHGAPAVLAQTWLEGTYTETYPEITQDEKGMRQFFRQF
STPGGIPSHVSAHTPGSVHEGGELGYSLAHAAGAVMDNPHLIAACVVGDGEAETGPLAGS
WKQNCFLNPARDGAVLPILHLNGYKISGPTVMGRMPDDALATLFNGYGYAPLFVRAADTI
GTHQEMAMALDTAYERIRAIQQYARDGKKTDERTLWPLIILRSPKGWTGPVMWKGKPVEG
TFRSHQVPLPDVREDQDQLALLEQWLRSYTPEKHFTANGAPQAALKALAPIGDKRMSATP
YANGGKDAQALVMPDFKNYAVTVNAPGVIIAEGTRELGKMLRDIFELNEQQQNFRVFCPD
ETTSNRLNAVFEVTKRCFMEHLIDIDDHLSPDGRVMEVLSEHLCQGWLEGYLLTGRHGVF
PCYEAFITIIDSMFNQHAKWLKTCREIPWRKDLPSLNYLLTSHSWRQDHNGYSHQGPGFI
DTVANKKSNVIRIYLPPDANCLLSVMDHCLKSRNYVNLVVAGKQPALQWLNVEDAAKHCA
QGASVWEWASNDNGQQPDVVLACAGDVPTLEIIAAAWLLRKHLPDLKVRVVNVVDLMSLS
PKDYHPHGLEAALFTSLFTDDTPVVFAFHGYVRIVHDLVHGRPHPARFHLRGFMEEGTTT
TPFDMVVLNKMSRFHLAIAAIQRTERQLEKADEVIGYFEDKLSMHNIYIRECLEDMPDIS
NWKWSDE
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atggcaacactcactaacgaacaagtacataacatacaggcttactgggaagcatccaat
tatctcgcagcagcacagatctatctgcaggataatccattgctgaaagatccgctgctg
accggccacatcaaaccaaggctcttaggtcactgggggacttctccaggtttgaacttt
atttatgtgcatcttaacagactcattaaatccagcgatgcagatatcctgttcatctgt
gggcccggacacggcgcaccagcagttcttgcacagacctggctggaagggacctatacg
gagacctatcctgaaattacacaggatgaaaaaggaatgagacagttcttccggcaattc
tccacacctggaggtattcccagtcatgtgagtgcacatacacccgggtctgttcatgaa
ggcggtgaactaggctattccctggcacacgcagcaggtgcggtaatggataatccccat
ctcatagcagcctgcgtagttggtgacggagaagctgaaaccggtccgctggcaggtagc
tggaaacagaactgtttcctcaatcctgcacgcgatggagctgtattaccaatactgcat
ctcaacggttataaaatatccggtcctacagtaatggggcgtatgccggatgatgcactc
gccaccttatttaacggatacggttacgcgcctttatttgtacgcgcggcagatacgatc
ggcacacatcaggaaatggccatggcgctcgacacagcttatgaacgaattagagcaata
cagcaatatgccagagatggaaagaaaacagacgaacgtaccttatggccgctcattata
ctccgttcccctaaaggctggacaggtcctgtcatgtggaaaggtaaaccggtagaagga
acgttccgctcccaccaggtaccactgcccgatgtcagggaagatcaggaccagctggcc
ctgctggaacaatggttacgcagttatacaccggaaaaacactttacagcaaatggcgct
ccacaggctgcactgaaggccctcgctcccattggtgacaaacgtatgagcgctacgcca
tacgccaatggcggcaaagatgcgcaagcgctggtgatgccggatttcaaaaactatgcg
gtaaccgtgaatgctcctggtgttattattgccgaaggcacacgtgaactgggaaagatg
ctacgcgatattttcgaactgaatgaacagcagcaaaacttccgtgtgttctgtcctgat
gaaacgacttccaacagactgaacgcggtgtttgaagtcactaagcgctgctttatggag
cacctgattgatatagatgatcatttatcccctgatggcagggtcatggaagtattgagc
gaacatctctgtcagggctggctggaaggttatctgctgaccggcagacacggtgttttc
ccttgttatgaagcctttatcaccattatcgactccatgtttaatcaacatgcaaaatgg
ttgaaaacatgccgggaaatcccctggagaaaagaccttccctcgctgaattacctgctg
acttctcatagctggcgacaggatcacaatggatatagtcatcagggaccaggttttatt
gataccgtcgccaataagaaaagcaacgttatccgtatctatctgccccctgacgcaaac
tgtctgctgtctgtcatggatcactgcctgaaaagcaggaactatgtcaatctggtggta
gcaggtaagcaacctgccctgcaatggcttaatgtggaagacgcagcgaaacattgcgca
cagggtgcttctgtgtgggaatgggccagtaatgacaatggtcagcaacctgatgttgta
ctcgcctgtgccggagatgtgcctacacttgaaattatcgcagcagcatggttacttagg
aagcatttacctgacttaaaagtaagagttgtgaatgtagtggacctgatgtcgctctct
ccgaaagattaccatccgcatggactggaggctgcattatttacctcacttttcacggac
gatacacccgtagtatttgcctttcatgggtatgtaaggattgtacatgacctcgtacat
ggacggccgcatccggcaagattccacctgagaggattcatggaagaaggcacgaccact
accccgtttgatatggtcgtgctcaataaaatgagccgcttccatctggccattgccgcc
atccagcggacagaaagacagctggaaaaagcagacgaagtgatcggctattttgaagat
aaactgagtatgcacaacatctacatcagggaatgcctggaagatatgcctgatatcagt
aactggaaatggagtgatgaataa

DBGET integrated database retrieval system