KEGG   Chitinophaga pinensis: Cpin_6494Help
Entry
Cpin_6494         CDS       T00959                                 

Definition
DNA-formamidopyrimidine glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cpi  Chitinophaga pinensis
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Cpin_6494
Enzymes [BR:cpi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Cpin_6494
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Cpin_6494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(8156471..8157250)
Genome map
AA seq 259 aa AA seqDB search
MPELPDLQVFSHNLDKALSGKKLKVIKLENTKKAKDTPAAFKKALEGETLESVYREGKEL
RFRFKNEAVLGMHLMLHGKLYYFEEENTNKHTVIALLFEDGKGLALTDFQGAAVPSLNPE
AAAAPDALSKEFTLTFLKEQLAKKKTAVKKILLDQHIIRGIGNAYADEILWEAGISPFSI
ANKIPATKVKALHAAIHNVLKEAEKQIRKEHPDIIAGEIRDFMKIHQPKKTHSPTGGVIE
QQELNSRKTYYTNEQELFE
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaattaccagatctgcaggtattcagccacaaccttgataaagcattatcaggt
aaaaaattgaaagtcattaaactggagaataccaaaaaagccaaggacacacccgcagct
tttaagaaagcattggaaggtgagacgctggagagcgtttacagagaggggaaggaactg
cgtttcaggtttaaaaatgaggctgtgctggggatgcacctgatgctgcatggcaagttg
tattacttcgaagaagaaaacacgaataaacatacggtaatagcgctgttatttgaggac
gggaaaggacttgcattgacggactttcaaggagcagcagtgccttcactgaatcccgaa
gcagcagcagcgcccgatgcattatcaaaggaattcacattgacatttctgaaggagcaa
ctggcgaagaaaaagacggctgtcaagaaaatactgctcgatcagcatattatcaggggt
attggtaatgcctatgcagacgagatattatgggaagccggtatttccccgttttctatt
gccaataagatccctgcaacgaaggtcaaagcgctgcatgcagcaattcataacgtgtta
aaagaagccgaaaaacagatccgtaaggaacatccggatatcattgcaggtgagatacgt
gattttatgaaaatacaccagcctaaaaagacgcatagtccgaccggaggtgttattgag
caacaagaactgaatagccggaaaacatattatacaaacgaacaggaactgtttgaatag

DBGET integrated database retrieval system