KEGG   Chitinophaga pinensis: Cpin_6497Help
Entry
Cpin_6497         CDS       T00959                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
cpi  Chitinophaga pinensis
Pathway
cpi00860  Porphyrin and chlorophyll metabolism
cpi01100  Metabolic pathways
cpi01110  Biosynthesis of secondary metabolites
Module
cpi_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cpin_6497
Enzymes [BR:cpi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Cpin_6497
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Cpin_6497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_3 Pyr_redox_3 FAD_binding_2 Thi4 Pyr_redox_2 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ACU63901
JGI: Cpin_6497
UniProt: C7PKZ1
Position
complement(8158758..8160086)
Genome map
AA seq 442 aa AA seqDB search
MQTQPVIIAGAGIAGLSIAYELQQKGIPYEIMEASSYAGGVVKSLHIDGYELDAGPNSLA
ASPEFMAYIDQLGLQEEVLEAAAASKNRFLVRNNKLHAVSPHPFKILQSDYISGGAKWRL
FTERFRKAAAPEGEETVSSFVTRRFGKEINEYLFEPVLSGIYAGNPDLMSVGEVLPMLPQ
WEKKYGSVTQGLMKNKGAMGGRKIIAFKGGNATLTNRLQSLLTSKIRFNCAITGVTRGAD
DYILQYTESGNTAMLNASRVIFTTPAYSTAVAIQGLDSSLAAHLSEVPYPRMGVLHLGFG
QEAQQKAPAGFGFLVPHAAGKHFLGAICNSAIFPSRVPTGKVLFTVFVGGARQEQLFDQL
GPEKLQQTVVNELMELLGLTTPPEMQRFSEWNRAIPQLNVGYAQTRQQIRFFEQRYPGIR
LGGNYVTGVAVPAIIQAAKGYC
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacacaacccgttatcattgccggcgccggtattgccggactaagtattgcctac
gaattacagcagaagggcattccctatgaaattatggaagcctcttcctatgcgggaggt
gttgtaaaatcattacatatagacggttacgaactggatgcaggcccgaattctctggcc
gcttctcccgagttcatggcctatatcgatcaactgggtttgcaggaggaggtgctggaa
gcagctgctgccagtaaaaaccgcttcctggtcagaaataataaattacatgccgtatct
ccacatccgtttaagatactgcaatcggactatatcagtggcggcgctaaatggcggttg
ttcacagaaagatttcgcaaagcggctgccccggaaggagaagaaacagtctcctccttt
gtgacccgccgctttggaaaggaaataaatgaatacctgtttgagcccgtactttccggc
atttatgcaggtaatcctgatctgatgtcagtaggggaggtcctcccgatgctgccacag
tgggaaaagaaatacggtagtgttacgcagggactgatgaagaataaaggcgctatgggc
ggccgtaagatcattgcctttaaaggaggtaatgccacactgaccaacagattacaatcc
ctgcttaccagtaaaataagattcaattgtgctataacaggcgttacccgtggggcagac
gactatattttacaatatacagagagcggtaataccgccatgttgaacgcatcccgtgtg
attttcacgacacctgcatatagtacggctgttgcaatacaggggctggattcttctctc
gccgcacatctcagcgaggtgccttatccccgtatgggcgtactgcaccttggattcgga
caggaagcccagcagaaagcaccggcgggttttggattcctggtgccacatgctgcagga
aaacatttcctgggcgctatctgtaacagtgctatattcccttcccgcgtgccaacaggc
aaagtattgtttacggtgtttgtaggtggcgcaagacaggaacagctgtttgaccaactg
ggacctgaaaagctgcaacaaaccgtagtaaatgaactgatggaactgctgggactgacg
acgcctcctgaaatgcaacgtttcagtgaatggaacagggcgatcccacagttaaatgta
ggttatgcacagaccagacaacagatccgcttctttgaacagcgttatcctggcatcaga
ctgggaggtaactatgtgacaggtgtggcggtgcccgctattatacaggcggcgaaagga
tactgttga

DBGET integrated database retrieval system