KEGG   Chitinophaga pinensis: Cpin_6497Help
Entry
Cpin_6497         CDS       T00959                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cpi  Chitinophaga pinensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cpin_6497
Enzymes [BR:cpi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Cpin_6497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(8158758..8160086)
Genome map
AA seq 442 aa AA seqDB search
MQTQPVIIAGAGIAGLSIAYELQQKGIPYEIMEASSYAGGVVKSLHIDGYELDAGPNSLA
ASPEFMAYIDQLGLQEEVLEAAAASKNRFLVRNNKLHAVSPHPFKILQSDYISGGAKWRL
FTERFRKAAAPEGEETVSSFVTRRFGKEINEYLFEPVLSGIYAGNPDLMSVGEVLPMLPQ
WEKKYGSVTQGLMKNKGAMGGRKIIAFKGGNATLTNRLQSLLTSKIRFNCAITGVTRGAD
DYILQYTESGNTAMLNASRVIFTTPAYSTAVAIQGLDSSLAAHLSEVPYPRMGVLHLGFG
QEAQQKAPAGFGFLVPHAAGKHFLGAICNSAIFPSRVPTGKVLFTVFVGGARQEQLFDQL
GPEKLQQTVVNELMELLGLTTPPEMQRFSEWNRAIPQLNVGYAQTRQQIRFFEQRYPGIR
LGGNYVTGVAVPAIIQAAKGYC
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacacaacccgttatcattgccggcgccggtattgccggactaagtattgcctac
gaattacagcagaagggcattccctatgaaattatggaagcctcttcctatgcgggaggt
gttgtaaaatcattacatatagacggttacgaactggatgcaggcccgaattctctggcc
gcttctcccgagttcatggcctatatcgatcaactgggtttgcaggaggaggtgctggaa
gcagctgctgccagtaaaaaccgcttcctggtcagaaataataaattacatgccgtatct
ccacatccgtttaagatactgcaatcggactatatcagtggcggcgctaaatggcggttg
ttcacagaaagatttcgcaaagcggctgccccggaaggagaagaaacagtctcctccttt
gtgacccgccgctttggaaaggaaataaatgaatacctgtttgagcccgtactttccggc
atttatgcaggtaatcctgatctgatgtcagtaggggaggtcctcccgatgctgccacag
tgggaaaagaaatacggtagtgttacgcagggactgatgaagaataaaggcgctatgggc
ggccgtaagatcattgcctttaaaggaggtaatgccacactgaccaacagattacaatcc
ctgcttaccagtaaaataagattcaattgtgctataacaggcgttacccgtggggcagac
gactatattttacaatatacagagagcggtaataccgccatgttgaacgcatcccgtgtg
attttcacgacacctgcatatagtacggctgttgcaatacaggggctggattcttctctc
gccgcacatctcagcgaggtgccttatccccgtatgggcgtactgcaccttggattcgga
caggaagcccagcagaaagcaccggcgggttttggattcctggtgccacatgctgcagga
aaacatttcctgggcgctatctgtaacagtgctatattcccttcccgcgtgccaacaggc
aaagtattgtttacggtgtttgtaggtggcgcaagacaggaacagctgtttgaccaactg
ggacctgaaaagctgcaacaaaccgtagtaaatgaactgatggaactgctgggactgacg
acgcctcctgaaatgcaacgtttcagtgaatggaacagggcgatcccacagttaaatgta
ggttatgcacagaccagacaacagatccgcttctttgaacagcgttatcctggcatcaga
ctgggaggtaactatgtgacaggtgtggcggtgcccgctattatacaggcggcgaaagga
tactgttga

DBGET integrated database retrieval system