KEGG   Chitinophaga pinensis: Cpin_6501Help
Entry
Cpin_6501         CDS       T00959                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cpi  Chitinophaga pinensis
Pathway
cpi00860  Porphyrin and chlorophyll metabolism
cpi01100  Metabolic pathways
cpi01110  Biosynthesis of secondary metabolites
cpi01120  Microbial metabolism in diverse environments
Module
cpi_M00121  Heme biosynthesis, glutamate => heme
cpi_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cpin_6501
Enzymes [BR:cpi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Cpin_6501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Amidase
Motif
Other DBs
NCBI-ProteinID: ACU63905
JGI: Cpin_6501
UniProt: C7PKZ5
Position
8163552..8164298
Genome map
AA seq 248 aa AA seqDB search
MPSNKRYRILSTRAVDPELVSSAAEQSVDIIPQAFIRTRPRVDDRLLQQVQQLLKEKVTV
VFTSVNAVNAIQNLYFRILPADAVTEQANMPGWDVYCLEGATKEALSRTAIPHNITGTAA
NAAMLAQTIVRNEEKGPLVFFCGDRRRDELPDILRQRNIGLNEVIVYETTETPAVTGATY
DGIFFLSPSAVQSFFSVNHLAQHTVCFSIGPTTAAALEQHTNNKIIISTGQRMADMVQTA
IFYFNNIN
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgccatcaaataaaagatatcgcatattaagcaccagagctgtagacccggaactggtc
agcagcgctgcggaacaatctgtagatattatcccgcaggctttcatccgtaccaggcca
cgggttgatgatcgtctgctgcaacaggtacaacaactgctaaaggaaaaggtaacggtc
gttttcaccagtgtgaatgcggtcaacgccatacaaaacctgtatttccggatcttgccg
gcagatgcagttacggaacaggccaatatgcccggatgggatgtatattgcctggaaggc
gctaccaaagaagccctttcccgtacagccattccccacaatattaccggcacagcagcc
aatgcagccatgctggcgcagaccattgtcaggaatgaagaaaaaggtccgctggtcttc
ttctgcggagacaggcgcagagacgaactgccagatatactacggcaacggaacatcggc
ctgaacgaagtgatcgtatacgagacaacggaaacgccggccgtcaccggagcaacatat
gacggtatcttctttctcagtcccagcgctgtacaaagcttcttctccgtcaatcacctt
gcgcagcataccgtatgtttttcaatcggcccgactacagcggcagcacttgaacaacat
accaacaataaaattattatcagcaccggtcagcgtatggctgatatggtgcagacagca
atattctattttaacaacatcaactga

DBGET integrated database retrieval system