KEGG   Chitinophaga pinensis: Cpin_6504Help
Entry
Cpin_6504         CDS       T00959                                 

Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cpi  Chitinophaga pinensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cpin_6504
Enzymes [BR:cpi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Cpin_6504
Exosome [BR:cpi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cpin_6504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8166276..8167241
Genome map
AA seq 321 aa AA seqDB search
MIRRNRILRTSPAIRAMVAETILTPSDFIAPLFIVEGENVKEEISSMPGYFRYSLDLTVK
EVKELWSMGIKSVLLFIKCADELKDNKGTEAVNPQGLMQRAIRAIKDAVPEIVVMTDVAL
DPYSSFGHDGIVENGEIVNDATVEVLSRMSLSHAEAGADFVAPSDKMDGRILSIRSMLEQ
HSFHKVGIMAYSAKYASCLYGPFRDALDSAPGFGDKKTYQLDYANSTQALKETLMDVQEG
ADIVMVKPALYYLDVIKKIKDEVNVPVSAYHVSGEYAMIKAAAKMGWLNEEKAIIEALTS
IKRAGADLIATYFAKDAVRLL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgatacgcagaaacaggatattgagaacatctcccgccatccgtgcgatggttgcggaa
acgatactgacgcccagcgattttattgcaccgttgttcattgtagaaggagaaaatgtg
aaagaagaaatttcttctatgcccggctatttccgttattcactggacctgacagtgaaa
gaagtgaaagagctctggagcatgggtatcaaaagtgtactgctctttatcaaatgcgca
gatgaactgaaagataataaaggtacagaagcggttaatccacaaggtctgatgcaacgc
gctatcagagcgatcaaggatgccgttcctgaaatagtggtaatgactgacgtagcgctg
gatccttactcttcctttggtcatgatggtatcgtggaaaacggagagattgtgaatgac
gctacggtagaagtactgtcccgcatgagcctcagccatgcagaagcaggtgctgatttt
gtcgcgccaagtgataaaatggatggtcgtatcctttccatccgtagtatgctggaacaa
catagcttccataaggtaggtatcatggcatatagcgcgaaatacgcttcctgcctgtat
ggtcctttccgcgatgccctggattcagctccgggcttcggcgataaaaagacctatcag
ctggattatgccaattccacccaggcactgaaagaaaccctgatggatgtacaggaaggc
gctgatattgtgatggtaaaaccagcactgtactatctggatgtgattaaaaagatcaaa
gacgaggtaaatgtaccggtgagcgcttaccatgtaagcggagaatacgctatgatcaaa
gcagccgcaaaaatgggctggctgaatgaagaaaaagctattattgaggcgttgaccagc
atcaaacgtgcaggcgccgatctgatcgcgacctatttcgcaaaagacgcggtgcgatta
ttgtaa

DBGET integrated database retrieval system