KEGG   Chitinophaga pinensis: Cpin_6562Help
Entry
Cpin_6562         CDS       T00959                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cpi  Chitinophaga pinensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cpin_6562
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cpin_6562
   00052 Galactose metabolism
    Cpin_6562
   00500 Starch and sucrose metabolism
    Cpin_6562
   00520 Amino sugar and nucleotide sugar metabolism
    Cpin_6562
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cpin_6562
   00524 Butirosin and neomycin biosynthesis
    Cpin_6562
Enzymes [BR:cpi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Cpin_6562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8230431..8231396
Genome map
AA seq 321 aa AA seqDB search
MSQQLAVGIDIGGTNTKFGIVDRRGNILCDGRMLTNQHEDVHGFLDELHEHLSVLIAQVG
GIENIRGIGVGAPNGNFYTGNIEYAPNLRWKGIIPLAKLLGEKFGVPAILTNDANAAALG
EFQYGAARSMRDFIVITLGTGVGSGIVANGQLIYGHDGFAGELGHCIVIPGGRYHPGTGA
HGSLEAYASATGVTNTALEFLANRPDTQSILRDHSKEEINSKVIYEAAMKGDPLAVEVYE
FTGKILGEALANFVMFSSPEAIILFGGLTKAGDMIMKPVREHMEKNLLPIFQNKVKLVFS
ELKESDAAILGASALAWEMKD
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagcaattagcggtgggcattgatattggaggaaccaatacaaagtttggcata
gtagatcgcagaggtaatattctgtgtgatggtcgtatgctaacgaaccaacacgaagac
gttcatggcttcctggatgagttgcacgagcatctctccgtattgatcgcacaggtaggt
ggcattgaaaacatcagaggtatcggtgtaggtgcaccaaatggtaacttttataccggt
aacattgaatatgctccaaacctccgctggaaaggtattatacctttagcaaaattgctg
ggtgaaaagtttggcgtaccggctatccttaccaatgacgctaacgcagcggcactcggt
gaattccagtacggtgctgcaagaagcatgagagatttcatcgttatcacgctgggtaca
ggggtaggtagcggtattgttgccaacggtcagctgatctatggtcacgatggcttcgca
ggtgaactcggtcactgtatcgtgatccctggtggcagataccatcctggtacaggcgca
cacggttccctggaagcatatgcttctgcaaccggtgtaaccaacactgccctggaattc
ctggctaaccgcccggatacacagagcatcctgcgtgatcattcgaaagaagagatcaat
tccaaagtgatatatgaagccgcaatgaaaggcgatccgctggcagtagaagtatacgaa
ttcaccggtaaaatactcggtgaggccctggccaactttgtcatgttctccagccctgaa
gcgatcatcctgttcggtggtctgaccaaagcaggcgacatgatcatgaaacctgtacgc
gagcatatggagaaaaacctcttgcctatcttccagaacaaagtgaagctggtcttctcc
gaactgaaagaaagcgatgcggctatcctcggtgcaagcgccctggcatgggaaatgaaa
gattaa

DBGET integrated database retrieval system