KEGG   Chitinophaga pinensis: Cpin_6602Help
Entry
Cpin_6602         CDS       T00959                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cpi  Chitinophaga pinensis
Pathway
cpi00020  Citrate cycle (TCA cycle)
cpi00640  Propanoate metabolism
cpi00660  C5-Branched dibasic acid metabolism
cpi01100  Metabolic pathways
cpi01110  Biosynthesis of secondary metabolites
cpi01120  Microbial metabolism in diverse environments
cpi01130  Biosynthesis of antibiotics
cpi01200  Carbon metabolism
Module
cpi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cpi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cpin_6602
   00640 Propanoate metabolism
    Cpin_6602
   00660 C5-Branched dibasic acid metabolism
    Cpin_6602
Enzymes [BR:cpi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Cpin_6602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ACU64006
JGI: Cpin_6602
UniProt: C7PMA1
Position
8277884..8279098
Genome map
AA seq 404 aa AA seqDB search
MNLHEYQAKELLKKYNVPVQEGIPVDTPEAAAEAYKQLKVQYGNEFAVVKAQIHAGGRGK
GTIRGKEQRGVAVGKNAEDVKTIAGNILGGVLVTIQTGEAGKLVNKVLVAQDVYYPGPNP
IKEFYLSILLDRAKGQNVIMYSTEGGMDIEEVAHNTPDKIFKELVQPNTTLQPFQARKIA
FNFGLSGEAFKNMVKFVTNLYNAYVGLDAAMLEINPLFKTSDEKIIAVDCKLNLDDNALM
RHADLEALRDINEEDPTEVEAGKFNLNYVKLDGNVGCMVNGAGLAMATMDMIKLSGGEPA
NFLDVGGTANAQTVEAGFRIILKDPKVKAILINIFGGIVRCDRVAQGVIDAYQSIGDIKV
PIIVRLQGTNAEEAKKLIEESGLKVQSAILLSEAAALVNKAVTA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgaataccaggctaaagaactgttgaagaaatataacgtaccggtacag
gaagggattccggtagatacccctgaagcggcagcagaagcttataagcaacttaaagtg
caatatggcaatgagtttgcagtcgtaaaggcgcagatacacgccggtggacgtggtaaa
ggtaccatccgtggtaaagagcagagaggtgtggctgtaggtaaaaatgcggaagatgtg
aaaaccattgccggaaacatcctgggtggcgtactggtgaccatccagaccggtgaagct
ggaaaattagttaacaaggtgctggtagcacaggacgtgtactaccctggccctaaccca
ataaaagaattctatctgtctatcctgctggatcgtgcaaaaggtcagaacgtgatcatg
tactctacagaaggtggtatggatatcgaagaggttgcacacaacactcctgataagatc
ttcaaagaactggtgcagccaaacactacccttcagccgttccaggcaaggaaaatagcg
ttcaacttcggtttgagcggtgaagctttcaaaaacatggtgaaattcgtgaccaacctg
tacaatgcgtacgtaggtctggacgcagctatgctggaaatcaacccactgttcaaaacc
agcgacgagaaaatcatcgcggttgactgtaaactgaacctggatgacaacgctctgatg
cgtcatgctgatctggaagcactgcgtgatatcaatgaagaagatccgactgaagtagaa
gcaggtaaattcaatctgaactacgtaaaactggatggtaacgtaggttgtatggtaaac
ggcgccggtttggcaatggctaccatggatatgattaaactgagcggtggtgagcctgct
aacttcctggacgtaggaggtactgcaaacgcacagaccgtagaagcaggtttccgtatc
atcctgaaagatcctaaggtaaaagcaatcctgatcaatatcttcggtggtatcgtacgt
tgcgaccgtgttgcacagggtgtaattgatgcttaccagtctatcggtgatatcaaagtg
ccaatcatcgttcgtctgcagggtacaaacgcagaagaagcgaaaaaactgatcgaagaa
agtggtctgaaagtacagtcagctattctcctgagcgaagctgctgcactggttaacaaa
gccgtgactgcttaa

DBGET integrated database retrieval system