KEGG   Chitinophaga pinensis: Cpin_6602Help
Entry
Cpin_6602         CDS       T00959                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cpi  Chitinophaga pinensis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cpin_6602 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cpin_6602 (sucC)
   00640 Propanoate metabolism
    Cpin_6602 (sucC)
   00660 C5-Branched dibasic acid metabolism
    Cpin_6602 (sucC)
Enzymes [BR:cpi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Cpin_6602 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8277884..8279098
Genome map
AA seq 404 aa AA seqDB search
MNLHEYQAKELLKKYNVPVQEGIPVDTPEAAAEAYKQLKVQYGNEFAVVKAQIHAGGRGK
GTIRGKEQRGVAVGKNAEDVKTIAGNILGGVLVTIQTGEAGKLVNKVLVAQDVYYPGPNP
IKEFYLSILLDRAKGQNVIMYSTEGGMDIEEVAHNTPDKIFKELVQPNTTLQPFQARKIA
FNFGLSGEAFKNMVKFVTNLYNAYVGLDAAMLEINPLFKTSDEKIIAVDCKLNLDDNALM
RHADLEALRDINEEDPTEVEAGKFNLNYVKLDGNVGCMVNGAGLAMATMDMIKLSGGEPA
NFLDVGGTANAQTVEAGFRIILKDPKVKAILINIFGGIVRCDRVAQGVIDAYQSIGDIKV
PIIVRLQGTNAEEAKKLIEESGLKVQSAILLSEAAALVNKAVTA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgaataccaggctaaagaactgttgaagaaatataacgtaccggtacag
gaagggattccggtagatacccctgaagcggcagcagaagcttataagcaacttaaagtg
caatatggcaatgagtttgcagtcgtaaaggcgcagatacacgccggtggacgtggtaaa
ggtaccatccgtggtaaagagcagagaggtgtggctgtaggtaaaaatgcggaagatgtg
aaaaccattgccggaaacatcctgggtggcgtactggtgaccatccagaccggtgaagct
ggaaaattagttaacaaggtgctggtagcacaggacgtgtactaccctggccctaaccca
ataaaagaattctatctgtctatcctgctggatcgtgcaaaaggtcagaacgtgatcatg
tactctacagaaggtggtatggatatcgaagaggttgcacacaacactcctgataagatc
ttcaaagaactggtgcagccaaacactacccttcagccgttccaggcaaggaaaatagcg
ttcaacttcggtttgagcggtgaagctttcaaaaacatggtgaaattcgtgaccaacctg
tacaatgcgtacgtaggtctggacgcagctatgctggaaatcaacccactgttcaaaacc
agcgacgagaaaatcatcgcggttgactgtaaactgaacctggatgacaacgctctgatg
cgtcatgctgatctggaagcactgcgtgatatcaatgaagaagatccgactgaagtagaa
gcaggtaaattcaatctgaactacgtaaaactggatggtaacgtaggttgtatggtaaac
ggcgccggtttggcaatggctaccatggatatgattaaactgagcggtggtgagcctgct
aacttcctggacgtaggaggtactgcaaacgcacagaccgtagaagcaggtttccgtatc
atcctgaaagatcctaaggtaaaagcaatcctgatcaatatcttcggtggtatcgtacgt
tgcgaccgtgttgcacagggtgtaattgatgcttaccagtctatcggtgatatcaaagtg
ccaatcatcgttcgtctgcagggtacaaacgcagaagaagcgaaaaaactgatcgaagaa
agtggtctgaaagtacagtcagctattctcctgagcgaagctgctgcactggttaacaaa
gccgtgactgcttaa

DBGET integrated database retrieval system