KEGG   Chitinophaga pinensis: Cpin_6735Help
Entry
Cpin_6735         CDS       T00959                                 

Definition
glycoside hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
cpi  Chitinophaga pinensis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cpi00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:cpi00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(8438589..8440046)
Genome map
AA seq 485 aa AA seqDB search
MRKYALMGLLLVAYTGYAKSEALSNRKDSTVRKGVTVYTTAENTKLRLSATATLSFAPMK
QPLETEVCIFVDPAKSFQTLTGIGGALTDASAEVWAKLPKEKQQELLKAYYDPVNGIGYT
LARTNIQSCDFSSGSYSYVKENDSLLKTFSIEHDQQYRIPFIKAVIGAAGGKIPLYVSPW
SPPAWMKDNNDMLHGGKLLAKYYQSWANFYVKFIKAYEAQGIPVWGLTVQNEPMAVQKWE
SCNYTAEEERDFIKRYLGPTLQKQGMAAKKLIAWDHNRDQVYQRASTILEDPAAAKYVWG
IGYHWYETWTGSAMMFDNVRRVAETFPGKNLVFTEGCVESFKYNRINEWFLGERYGLSLV
NDFNNGTVAWTDWNILLDENGGPNHVGNFCFAPVHADTKTGELIYTNAYYYLGHFSKFIR
PGAKRVIASSNRTDLQTTAFINKDGKLAVVVLNLSDKEIPYKLWIKGEAAAANSLPHSIA
TLIVD
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagtatgctttgatgggcctcttactggtagcatataccggttatgcaaaaagt
gaggccctgagtaacaggaaggattccaccgtacgcaaaggtgtgacggtgtatacaacc
gccgagaataccaaactgcgtttgtcagcaacagcaacgctgtcttttgcacccatgaag
cagccgctggaaacagaagtctgcatatttgtagatcctgctaaaagtttccagacactg
actggtatcggtggcgcgctgacagatgcttctgcggaagtatgggcaaaactgccaaaa
gagaaacaacaggaactgctgaaggcgtattacgatccggtaaatggtatcgggtatact
ttggcgagaactaatattcagagctgcgacttctccagcggttcttacagctatgtaaag
gagaatgacagcctgttaaaaacattcagtattgaacatgaccagcagtaccgcatccct
tttattaaggcggtgataggcgctgccggtggaaagataccattgtatgttagcccctgg
agccctccggcctggatgaaggataacaacgacatgctgcatggcggtaaactgttagcg
aagtattaccagtcatgggccaacttctacgtgaagtttatcaaagcttatgaggcacag
ggtattcctgtatggggactgacagtgcagaatgaaccaatggctgtacagaaatgggag
tcctgtaattatactgcggaagaggagagagatttcatcaaacgttatctcggacctacc
ttacagaaacaggggatggctgctaagaagctgatcgcatgggatcacaaccgcgaccag
gtatatcagcgcgccagcactattctggaggatcctgctgctgcaaagtatgtatggggt
atcggttaccactggtatgaaacatggaccggcagtgctatgatgtttgacaacgtacgc
cgtgttgcagaaacattcccgggtaagaaccttgtctttacagaaggttgtgtagagtct
ttcaaatacaaccgtatcaatgaatggttcctgggagagcgttatggtctttccctggta
aatgatttcaataatggtactgttgcctggacagactggaacatcctgctggatgaaaat
ggtggtcctaaccacgtaggtaacttctgctttgcacctgtacatgcagatacaaagacc
ggagaactgatctacacaaatgcttattactacctgggtcatttctccaaattcatccgt
ccgggtgctaagcgtgtgattgcttcttctaacagaacagatctgcaaacaactgcattt
atcaacaaagatggtaaactggcggtagttgtactgaacctgtctgataaggagattcct
tacaaactgtggataaaaggggaagcagcagctgcaaacagtctgccgcactctattgcc
accctgatcgttgactaa

DBGET integrated database retrieval system