KEGG   Chitinophaga pinensis: Cpin_6736Help
Entry
Cpin_6736         CDS       T00959                                 

Definition
glycoside hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
cpi  Chitinophaga pinensis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Cpin_6736
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Cpin_6736
Enzymes [BR:cpi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Cpin_6736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(8440069..8441526)
Genome map
AA seq 485 aa AA seqDB search
MIFHYKTRISLTALLLSGMIAFAGCKDNGTETPVRPVDPTVEKDTTDVLMWLTKGDKSVL
LKQQKVNLLFKDTLNVYPTIKVDASQTYQSIDGFGYCLTDGSAMLINSLPADAQDALLKE
LFLPDTAHLGVSYLRVSIGASDLSVAPFTYNDLPTGQTDVDMTKFSIEKERKDLLPILKK
VVALSPNIKILGSPWSAPSWMKTNNASKGGSLKPEYYAAYARYFVKYIQAMKAEGITIDA
ITPQNEPLHGGNNPSMVMQANEQADFVKNHLGPAFKAAGLTTKIIVYDHNADKPEYPAAI
LGDAAAYSYVDGSAFHLYGGSITALTQLHDAYPEKNIYFTEQWVGGPGNFGNDLQWHVST
LIVGATRNWSRNVLEWNLAADANYGPHTDGGCTTCLGALTIGSGVIRNVAYYIIGHASKF
VRPGAVRIASNITSQLDNVAFKTPDGKTALIVVNSGSTPQTFNIQSNGKIVTTSLTNGAV
ATYIW
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgatattccactataaaacccgtatcagcctgacggctttactgctgtccgggatgatc
gcttttgccggctgtaaggataatggtactgaaacccctgtcagacctgttgatccgact
gtagaaaaagatactactgatgtgttgatgtggctgacaaaaggagacaaatcggtactc
ctgaagcaacagaaagtcaacctgctttttaaggatacgctgaatgtatatcctaccatt
aaagtggatgcttctcaaacataccagtcgatagatggctttggttactgtctgacagac
ggtagcgcgatgctgatcaattcactgccggctgatgcacaggatgcattgctgaaagaa
ttattcctgcctgatacagcgcatctgggtgtgagctacctgcgcgtgagcattggcgcc
tccgatctgagcgtggcgccttttacctataatgatctgccgaccggacaaacggacgtg
gacatgactaaattcagcatagagaaggaaagaaaagacctgttgcctattctgaagaaa
gtagtggccctgtcacccaatattaaaatactgggttctccctggtcagctccttcctgg
atgaagacaaataacgcttctaaaggcggtagtctgaaaccggaatactatgctgcctac
gccagatattttgtgaaatatatccaggctatgaaggcggaaggcatcaccatagatgcc
atcactccacagaacgaaccgctgcatggtggtaataatccaagcatggttatgcaggcc
aatgagcaggctgattttgtaaagaatcacctgggacctgcttttaaagctgccggtctg
actactaagatcatcgtgtacgatcataatgcagataaaccggaatacccggctgcgata
cttggtgacgctgctgcctattcttatgtggatggctcggctttccatctctatggtggc
agtatcacagcgctgacgcagttgcatgacgcttatccggagaagaacatctacttcact
gaacagtgggtaggtggtccaggtaatttcggtaacgacctgcaatggcatgtgagcacc
ctgattgtaggcgctacccgtaactggagccgtaatgtgctggaatggaacctggctgct
gacgctaattatggtccgcatacagacggtggttgtactacttgcctgggcgcgttgaca
attggttcaggagtaattcgtaacgttgcgtattatatcatcggacatgcctctaaattt
gtacgtccgggtgctgtcaggattgcttccaatatcaccagtcagctggataacgtggca
ttcaaaactcctgatggcaagacggcactgatcgtggtaaatagtgggtctactccacag
acgttcaatatccagtccaacgggaaaattgtaactacttccctgactaacggtgcagta
gctacttatatctggtaa

DBGET integrated database retrieval system