KEGG   Chitinophaga pinensis: Cpin_6839Help
Entry
Cpin_6839         CDS       T00959                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cpi  Chitinophaga pinensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cpin_6839
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cpin_6839
  Amino acid metabolism
   00310 Lysine degradation
    Cpin_6839
Enzymes [BR:cpi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Cpin_6839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(8566336..8567910)
Genome map
AA seq 524 aa AA seqDB search
MAIEIKVPTVGESISEVTIAKWLKKDGDYVQQDEVICEMESEKATFELNAEKAGVLKILA
PEGATLKVGDIACSIDTDAAAPAGGSAPAAAPAAPAPVAETPAPAAEAPAAPAVNKGTIE
MKVPTVGESISEVTLIKWLKKDGEFVERDEVICELESEKATFELNAEEAGALQTLGKEGD
VLKVGDPIAKIDTSVGRPAGKAQPAAAAAPAATPQAAPQVQQAPVTAIPNDVKASPVAAA
VIADKHVDPSSIKGTGAHGKIMKDDVFAALQNPGVAIGQEMFTRAERREKMSNLRKTVSR
RLVEAKNTTAMLTTFNEVDMTAIMELRAKYKEIFKKQHEVNLGFMSFFTKAVCFALKEFP
SVNAYIDGEELVFHDYCDVSIAVSAPKGLVVPVIRNAESLDMAQIEKKVVELATKARDNK
LTMDEMTGGTFTITNGGVFGSLMSTPIINIPQSAILGMHKIQERPMAVNGQVVIRPMMYL
ALSYDHRIIDGRESVSFLVRVKEMLESPEQLLFGKDPLKALLKL
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaaagttcctacggtaggagaatctattagcgaggtaacaattgca
aagtggttgaagaaagacggagattatgtacagcaggatgaggtgatctgtgaaatggaa
tctgaaaaagccacctttgaactgaatgcagaaaaagcaggggtcctgaaaatactggct
ccggaaggcgctactttaaaagtaggcgatattgcttgttcaattgatacggatgctgcg
gctccggcaggcggatcagcaccagctgctgcacctgcagcgccagctcctgtagcagaa
acaccggcgccggcggcagaagctcctgcagcaccggcggtgaacaaaggaacgattgag
atgaaagtgcctactgtgggcgaatccatcagcgaagtgacattgatcaagtggctgaag
aaagacggcgagtttgtagagcgtgatgaagtgatctgcgaactggaatctgaaaaagct
actttcgaactgaacgcagaagaagctggtgcattacagactttaggtaaagaaggagat
gtattaaaggtaggtgatcctatcgctaaaatagataccagtgtaggacgccctgcaggt
aaagcacaaccggcagcggctgctgctccggctgcgacaccacaggctgccccacaggta
caacaggcgcctgtaaccgctatcccgaacgatgtgaaagcaagtccggtagcagccgca
gtaatcgccgacaaacacgtagatccgtcctctatcaagggtaccggcgctcatggcaaa
atcatgaaagatgatgtttttgctgcgctgcagaacccgggtgtggctatcggtcaggaa
atgttcacccgcgcagaacgtcgcgagaaaatgagcaacctgcgtaagaccgtttcccgc
cgtctggtagaagcgaaaaacaccacggcgatgctgactaccttcaacgaggtagatatg
acagcaatcatggaactgcgtgctaaatacaaagagatcttcaagaaacaacacgaggtg
aacctgggcttcatgagcttcttcactaaagcggtttgtttcgcactgaaggaattccct
tctgtgaatgcatatatcgatggcgaagaactggtattccacgactactgtgatgtatcc
atcgcagtatctgcaccgaaagggctggtagtaccggtgatccgtaacgcggaaagcctg
gatatggcacagatcgagaagaaagttgtagaactggctacaaaagcccgtgacaacaaa
ctcaccatggatgaaatgaccggtggtaccttcaccatcaccaacggtggtgtattcggt
tccctgatgagtactccgatcatcaatatcccgcagtctgctatcctgggtatgcacaaa
attcaggaacgcccgatggctgttaacggacaggtagtaatccgtccgatgatgtacctg
gcactcagctatgaccaccgtatcattgatggtcgtgagtctgtaagcttcctggtacgt
gtgaaagaaatgctggaaagccctgagcagttactgttcggtaaagatccactgaaagca
ttactgaaactctaa

DBGET integrated database retrieval system