KEGG   Chitinophaga pinensis: Cpin_7085Help
Entry
Cpin_7085         CDS       T00959                                 

Definition
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cpi  Chitinophaga pinensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cpin_7085
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cpin_7085
   00020 Citrate cycle (TCA cycle)
    Cpin_7085
   00620 Pyruvate metabolism
    Cpin_7085
Enzymes [BR:cpi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Cpin_7085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8866381..8868021
Genome map
AA seq 546 aa AA seqDB search
MAEVIRMPLLSDTMTEGVIAEWHKKVGDTVKADDVIAEVETDKATMEVMGYVEGTLLYIG
VEKGKAAKVNEIIAIVGKPGEDYKSLLGGGNNNGQAAPEAKPAAQEASAPAPAASTADSA
AVAEALKNATVIRMPLLSDTMTEGKIVAWNKKVGDTVKSDDVLAEVETDKATMEVIGYAD
GELLYVGVKEGDAAKVNGIIAIVGKKGTNVDVILAAEGTGGAKPAAQAAPAATPAASAAP
AATPEVSENKDGGRVKASPLAKKLAEEKGIDINKVTGSGDGGRIVKKDVDSFVPSAAPAA
AAKPGAAPAAKAAAFAPAGQEGHTDIQLSQMRKVIAKRLSESKFSAPHFYLKVDINMDKA
IEARKAINEVSPVKISFNDMVIKASALALRQHPDVNSSWMGDFIRQNHHVHIGSAVAIED
GLIVPVIRFADQKSLSQIAADAKELYDKAKNKKLQPQDFSGNTFTISNLGMMGIDEFTAI
INPPDSAILAVGGIKETVVSEKGQFKAVNIMKLTLSCDHRSVDGAVGARFLATLKSYLEN
PVTMLV
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagttatcagaatgccccttttgagtgacactatgactgaaggggtgatcgcg
gaatggcataaaaaggtaggtgataccgtaaaagcagacgacgtaattgctgaggtggaa
acagataaagccaccatggaagtaatgggttatgtggaaggtactctattatatattggt
gtcgagaaaggtaaggctgctaaagtaaatgagattatagctattgtagggaaaccaggt
gaagactacaagtctttgctgggtggaggaaataataatggccaggccgcacctgaggct
aagccagcagctcaggaagcttccgctccggctcctgccgcaagcaccgcagacagcgca
gctgttgctgaagcactgaaaaacgccactgttatccgtatgccgctgttaagcgatacc
atgacagaaggtaaaatcgtagcctggaacaagaaagtgggcgacaccgtaaaaagcgat
gacgtattagcagaagtggaaactgataaagcgaccatggaagtaatcggttatgcggat
ggtgaactcctttatgtaggcgtaaaagaaggtgatgctgctaaagtaaacggcatcatt
gcaatagtaggtaaaaaaggtaccaatgttgacgttatcctggctgcagaaggcacaggt
ggcgctaaaccggccgctcaggcagcaccagcagctactccggctgcatctgcagctcct
gcagctactcctgaagtttctgaaaataaagatggtggtcgtgtaaaagcatctccgctg
gctaagaaactggctgaagaaaaaggtatcgatatcaataaagtaactggttccggcgac
ggtggcaggatcgtgaagaaagacgtagatagctttgttccatctgctgctccggctgca
gccgcgaaaccaggtgctgctcctgctgcgaaagctgcggcatttgcaccagcaggtcag
gaaggtcatacagacatccagctgagccagatgcgtaaagtgatcgctaagcgtctgagc
gaaagcaaattctccgctcctcacttctacctgaaagtagatattaacatggataaagcg
attgaagcgcgtaaagctatcaacgaagtatctcctgttaagatctccttcaacgatatg
gtgatcaaggcttctgccctggcattgcgtcagcatcctgatgtaaacagcagctggatg
ggtgatttcatccgccagaaccaccacgtacacatcggttctgctgtggctatcgaagat
ggtctgatcgttcctgtaattcgttttgctgatcagaaatcgctgagccagatcgcggct
gatgcgaaagagctgtacgacaaagcgaaaaacaaaaaactgcaaccacaggatttctct
ggtaataccttcactatctccaatctgggtatgatgggtatcgacgagttcactgctatc
atcaaccctccggattccgcaatcctggctgtaggtggtatcaaagaaaccgttgtttct
gagaaaggacagttcaaagctgtaaacatcatgaaactaaccctgagctgtgaccaccgt
agtgtggacggagcagtaggcgcacgtttcctggctacgctgaagagctacctggaaaat
ccggttacaatgctggtatag

DBGET integrated database retrieval system