KEGG   Chrysemys picta (western painted turtle): 101934215Help
Entry
101934215         CDS       T04662                                 

Gene name
ABHD12B
Definition
(RefSeq) abhydrolase domain containing 12B
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
cpic  Chrysemys picta (western painted turtle)
Brite
Enzymes [BR:cpic01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     101934215 (ABHD12B)
Peptidases [BR:cpic01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   101934215 (ABHD12B)
Exosome [BR:cpic04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   101934215 (ABHD12B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 337 aa AA seqDB search
MYINGTYLSYRRRASWLFRTLILHLFVIYVSVPFLIRLFPALLAKFVFLNIVAFPFVDFG
KPELLLNHTVNFYLTTEPEVTIGVWHVLPGSRGIEAQGKDHSWYEETLADDNPVIIYLHG
NGGNRASGHRVSLMKVMSAAGFHILALDYRGYGDSSGYPSETGFTTDVMCLYDWVKARSG
NSTVLFWGHSLGSGVATNVARKLLEEKGIQVDLIVLESSYTNIREAAAHIPITRIYRQFP
GFEYFILDSMALGDMFFRSDENVKVLSSPLLILHSEDDPILPIHLGRKLFEIALHSYENK
DKVKFVAYPEKLGLAHENICSDPELPDIVKDFLKNIK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgtatattaatgggacttatttgtcttacaggaggagggcatcctggttattcagaacc
ctaatcctgcatctcttcgttatttatgtttctgtaccattccttatacgtctctttcct
gcactgttggccaagtttgtctttctcaatattgtggcatttccctttgtggactttggg
aaacctgaattgctgctgaaccatactgtaaacttctatctcacaaccgaaccggaggtc
accatcggcgtctggcatgttttgcctggcagcagggggatagaagctcaagggaaggat
cacagctggtatgaagaaactcttgcagacgataatcctgttataatttatctccatggc
aatggaggtaacagggcttcagggcaccgagtttccttgatgaaggtgatgagtgctgca
ggcttccatatactggctcttgactacagagggtatggggactcgagtggctatccaagt
gagacgggatttactacggacgtcatgtgcctctatgactgggtaaaagcccggagtgga
aatagcacagtgctcttctggggacactccttgggcagtggagtagcaacaaatgttgca
agaaaactgcttgaagaaaaaggcatccaggtggacttgatcgttctggaatcgtcctac
accaacattcgggaggcagcagctcatatccccattaccagaatctaccgtcagttccca
ggatttgagtacttcatcctcgactcaatggcgttgggtgacatgtttttccgtagtgat
gagaatgttaaagtgctgtccagtccccttttgattttgcattcagaagatgaccctatc
ttgcccatccacctgggtagaaagctctttgagattgctctccactcctatgagaacaaa
gacaaggtcaagtttgttgcctatccagagaagctgggtttagcccatgaaaacatctgt
tcagatccagaactgccagacattgtgaaagacttcctgaagaacatcaagtga

DBGET integrated database retrieval system