KEGG   Chrysemys picta (western painted turtle): 101939174Help
Entry
101939174         CDS       T04662                                 

Gene name
ABHD12
Definition
(RefSeq) abhydrolase domain containing 12
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
cpic  Chrysemys picta (western painted turtle)
Brite
Enzymes [BR:cpic01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     101939174 (ABHD12)
Peptidases [BR:cpic01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   101939174 (ABHD12)
Exosome [BR:cpic04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   101939174 (ABHD12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
17
AA seq 380 aa AA seqDB search
MRKRNESVTLEHERPAGPPEPGCSLRPSLRLARPHGEPAMKRPLGRRYGLWFRLRKLLIW
LLGVYIAIPFLVKICPAIQVKLVFLNFVRVPYFIDLKRPQDQGLNHTYNYYLQPEEDVTI
GVWHTVPGALWKDAQGKGQPWYEDTLGSNYPVILYLHGNAGTRGGDHRVELYKVLSSLGY
HVVTFDYRGWGDSVGTPSERGMTYDALHVFDWIKARSGDNPVYIWGHSLGTGVATNLVRR
LCERETPPDALILESPFTNIREEARSHPFSVIYRYFPGFDWFFLDTITMSGIKFANDENV
KYISCSLLILHAEDDPVVPFHLGKKLYNIAAPSRSFRDYKVQFVPFHRDLGYRHKYIYRS
PELPRILREFLGKSEHAHHH
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagcggaacgagtccgtcacgctggagcatgagcgccccgccggcccgcccgag
ccgggctgcagcctgaggcccagcctgcgcctggcccggccccacggcgagccggccatg
aagcgcccgctcggcaggcgatatggattgtggttccgattacggaagttgttaatatgg
ttgttgggagtatacatagccattccatttctagtaaaaatttgtcctgctattcaggtg
aagctggtcttcttaaattttgtgagggttccatatttcattgacttgaaaaggccacag
gatcaaggcttaaaccacacctataattattaccttcagccagaggaggatgtaaccatt
ggagtctggcacacagttccaggagccttatggaaagatgctcaaggcaaaggccagccg
tggtatgaggacactttgggatccaactatcctgtaatcctttacttgcacggaaatgca
ggaactagaggaggggatcaccgggtggaactttacaaggttctaagttcccttggttac
catgtagtcacatttgattatcgagggtggggagattctgtgggcactccatcagagaga
ggaatgacctatgatgcactccatgttttcgactggataaaagcaagaagtggagacaat
cctgtctatatatgggggcattccttaggcacaggagttgcaacaaatttagtgaggcgt
ctttgtgaaagagaaactcctccagatgccctaatactggaatcgccattcactaatata
cgggaagaagcaagaagccatccgttttcagtgatatatagatacttccctggatttgac
tggttcttccttgacaccatcacaatgagtggaattaaatttgcaaatgatgagaatgta
aaatacatttcctgctcgctgcttattcttcatgctgaagatgatcctgttgtaccattt
catcttggaaagaagctttataacattgctgcaccatctcggagtttccgtgactacaaa
gtacagtttgttccatttcacagagacctcggctacaggcataagtacatatacaggagt
ccagagctacctcgaatactgcgggaattcctgggaaaatctgaacatgcacatcatcac
tga

DBGET integrated database retrieval system