KEGG   Chlamydia pneumoniae J138: CPj0208Help
Entry
CPj0208           CDS       T00032                                 

Gene name
pfkA_2
Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cpj  Chlamydia pneumoniae J138
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:cpj01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cpj01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cpj00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cpj00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cpj00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism
Metabolism; Energy metabolism; Methane metabolism [PATH:cpj00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
248568..250220
Genome map
AA seq 550 aa AA seqDB search
MHPLYVDLDTIISSYSPPLPKEFQEAASLIAVPDTSHSKPVVPGVKTLFPQTYHLPYLKF
VQGENVVHTPLKVGVMFSGGPAPGGHNVIQGLFNSLKDFHPDSSLVGFVNNGDGLTNNKS
IDITEEFLSKFRNSGGFNCIGTGRKKIVTPEAKEACLKTAEALDLDGLVIIGGDGSNTAT
AILAEYFAKRRPKTSIVGVPKTIDGDLQHTFLDLTFGFDTATKFYSSIISNISRDALSCK
AHYHFIKLMGRSASHIALECALQTHPNIALIGEEIAEKNLPLKTIIHKICSVIADRAAME
KYYGVILIPEGIIEFIPEIINLITEIESLSEYEDKISRLSPESQRLLKSFPAPIIEQILN
DRDAHGNVYVSKISVDKLLIHLVSNHLQQYFPNVPFNAISHFLGYEGRSGLPTKFDNTYG
YSLGYGAGILVRNHCNGYLSTIESLACPFMKWKLRAIPVVKMFTVKQQADGTLQPKIKKY
LVDIGSTAFRKFKLYRKIWALEDSYRFLGPLQIETPPEMHSDNFPPLTLLLNHNFWQRHQ
GCIEIPDTTY
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgcatcctttatacgttgatcttgatactattatcagctcctactctcctcccttacct
aaagaatttcaagaagcagcctctttaattgctgttccagatacttcacattctaagcct
gtcgttccaggagtgaaaaccctctttccacaaacctaccaccttccctatctaaagttt
gtccaaggagaaaatgtcgttcacactcctctaaaagtaggcgtaatgttctcaggagga
cctgctccaggaggacataatgtcatccaaggactcttcaatagtctaaaagatttccat
cccgattcctccctcgtggggttcgtaaataatggagacggtcttacaaacaataaaagc
atagacattactgaagagtttctctccaaattccgaaattccggaggcttcaactgtata
ggaacaggaaggaaaaaaattgtaactccagaagctaaagaggcttgtctaaagaccgca
gaggctctggatctcgacggactagtcattattggcggtgatggctccaatacagcaacc
gctattcttgcagagtattttgcaaaacgacgcccaaaaacctctattgtcggagttcct
aaaactatagatggggatctacaacacaccttcttggatctgaccttcggatttgatact
gcaacaaaattctactcttcaatcattagcaatatttcaagagatgctctttcctgtaaa
gctcattaccacttcattaaacttatgggacgctcagcatcccatattgctttggaatgt
gctctccaaactcatccaaatattgcccttatcggcgaagaaattgccgaaaaaaatcta
ccactaaaaaccatcatccataaaatctgctccgtaattgcagatagagccgctatggaa
aaatactatggcgtcatcctcatcccagaaggcattatcgagttcatcccagaaatcatc
aacttaattacagaaatcgaaagcctatcagaatacgaagataaaatctccaggctctct
ccagaatcccaacgcctactgaaaagcttcccagcacctatcatcgagcaaatcctcaat
gaccgcgatgctcacggtaatgtctatgtttctaaaattagtgtcgataaactactcatc
cacctggtcagcaatcatctccaacaatatttccctaacgtccctttcaatgcgatctca
cattttctaggatatgaaggacgctcgggattgcctacaaaattcgataatacctacggc
tatagcctcggatacggcgccggtattctcgtccgcaatcactgcaacggctatctctct
actatagaatccctagcatgccctttcatgaaatggaaattacgggcaattcccgtagtg
aaaatgttcacagtaaaacaacaggcagatggaactctacaacctaaaattaaaaaatac
ctcgtagatataggaagcacggcatttcgtaaatttaagctctataggaaaatttgggcc
ctcgaagactcctaccgattcctagggcctctacaaatagaaactcctccagaaatgcac
tctgataatttccctcctcttacccttttgcttaatcataacttttggcaacgtcaccag
ggttgcatagaaatccctgatactacgtattaa

DBGET integrated database retrieval system