KEGG   Chlamydia pneumoniae J138: CPj0737Help
Entry
CPj0737           CDS       T00032                                 

Gene name
recC
Definition
exodeoxyribonuclease V subunit gamma
Orthology
K03583  
exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
cpj  Chlamydia pneumoniae J138
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cpj03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
827006..830080
Genome map
AA seq 1024 aa AA seqDB search
MNATKHCRASFSNSPRHLLAQLAEDITSTHQKPFTKRWILVANATTGHWIKNQLVHVLSD
HIFMGSTIFTASDSIVKHLFLGSGCSQPNIPDYLTLPLLINNILEEISKASKFENGREFL
SPPTYETTKKLAAAFKQFHTFSQRPTKNASHYQELFQILESHFSSYEEMFTTILNNRTQE
EDCSLHIFGYAHLPKHLAEFFINLSTYFPVYFYCFSPCREYFGDLLSDRAIDFFWNQLPD
SPIKNAWEHYVLSDRQALLANLAHKSQSSQNFFLDREIDYQEMFLPSKHDSSLGVIQNSI
LDLKPTSPQDFSQTKQTICIYRALNIPREVQEVFCKVTELLHRGVSPEEIFILSSHIESY
KVHLNAIFNPHVPIYFTDEVDPRAEDLRNKILLLSSILQTQGDLHYILQLLTHPQLQQPI
DQNKVPYLIKKLSSEWGKISSKDRASGQQMKALGDLILEEYPFHQEGGRVSQVEVWETTV
PLIYFIQERINLYLSSSQHSYEDLFQNVFSCLEKIFVLSPEETSFITTLRNSLFPTFATS
SCSLLFFTDFCLDFLLHFHKPSPLYDKPGPYIGSLSSLSLIPKGYVFILGANKTTSSDIF
DLLNRTTTHEELAFSSTEDEENFHFLQILVSTKHELHISYISSAAQFNLPSPFLNHIKET
LDLPVETLPTQPYLSAFFKNKACLHTSQEYNYSLAHAFYSKKALLPSLFIPTVKQVNLPQ
HLSLNEIIKGIFSPLDLFLKTNYNLRISYPEHLKKQQKLFPTKHQIEDFWNECFVDKEHD
LIPSISPHAEELFTYYREKTILLRNGLDKDPKHSPYTVTFSSSIFEERPYHESYLFPPLS
LSFQGNPVQIHGTIHGVCNEGLYLCSIDPGDSLKKTTRTLGSLPETSSEQKQLLERYVAL
AVLQMSQHLSSDSALIKLTSFNTKENHHPPFSDPEGYLRKVLEVYHLMSSQPIPLLSPLC
WKTLDDEEKFHQAVLSAISEEAKNPSLPIFWQFHNRNIEEILNHVGASERLKILSLFRGP
CEAV
NT seq 3075 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccaccaaacattgtcgagcaagcttcagtaactcgccccgtcacctcctagct
cagcttgcggaggatattacgtccacacatcaaaaaccttttaccaaaaggtggattctt
gttgcaaatgctactacagggcactggataaaaaaccaacttgtacatgtcttgtcagac
cacatctttatgggatcaactattttcactgcttcggattccattgtcaaacacttattc
ttgggttcgggttgctcgcagcccaatattccggactaccttacccttcccttgttaata
aataatattttagaagaaatctcgaaggcttccaaatttgaaaatggaagggagttttta
tctccacccacatacgaaacaacaaaaaaacttgctgctgcgtttaagcagttccatacg
ttttcacaacgcccgaccaaaaacgcctcccattaccaagaattatttcaaatcttggaa
agccatttttcttcttatgaagagatgttcaccactattttaaataatcgaacgcaagag
gaggactgctcccttcatatttttggttatgctcatcttcccaaacatcttgcggaattt
tttattaatttaagtacgtatttccctgtatatttctattgtttttctccctgtcgagaa
tattttggtgatttactttccgatagagctattgatttcttttggaatcaacttcccgac
tccccaataaaaaatgcctgggaacactatgtattatcagacaggcaagcacttcttgca
aacttagctcataaatctcagtcgtcgcaaaattttttcctagatagggaaatagactat
caagagatgtttctcccttcaaaacacgatagttctttaggggtaatacagaactctatt
ttagacctcaagcccacgtctcctcaagatttctctcaaacaaagcagaccatttgtatt
tatagagctctaaatattcccagagaagtccaggaggtattttgtaaagttacagaactt
ctgcatcgcggagtgtcacctgaggagatttttattctctcttctcacatagagagctac
aaggtacatctaaacgctattttcaatcctcatgtgcctatatactttactgatgaagta
gatccacgggctgaagatctcagaaataaaatcctcctactttcttctattttacaaaca
caaggggatttacattacattcttcaactccttacgcacccacaactacaacaacctata
gatcaaaacaaggttccctatctgattaaaaagctttcctcagaatggggaaaaatttct
tcaaaagaccgagcttcgggtcaacaaatgaaagctctaggtgatctgatattagaagaa
tacccattccatcaagagggtgggcgtgtgagccaagtagaagtttgggaaacaacagta
cctttaatttatttcattcaagagcgtatcaacctttatctttccagctcccaacatagc
tatgaagatctatttcaaaacgtgttttcttgtttagaaaagatttttgttttatctccc
gaagagacctctttcattacaacgttaaggaactctcttttcccaacctttgctacatct
tcctgttctcttctttttttcactgatttctgtttagactttttgcttcatttccataaa
cccagtcccctgtatgacaagccaggaccttacataggtagtttgagtagcctcagctta
attcctaaaggctatgtctttattttaggagctaataaaacaacatcgtctgacattttt
gatcttttaaataggacaacaacacatgaagagcttgcattttcttctacagaagacgag
gaaaatttccacttcctacaaattttagtctctacaaaacatgaacttcatattagttat
atatcatcggcagcgcaattcaaccttcctagtccctttctaaaccatattaaagaaacc
ttagacctgcctgtagaaacgttacctacacaaccctacctctctgctttcttcaagaat
aaagcttgtttacacacctctcaagaatacaactactctcttgctcatgctttctattct
aaaaaagctctcctcccttccttgtttattccaactgtaaagcaggtaaatcttcctcaa
catctctctctcaatgaaattatcaaaggaatcttttctcctttagacctctttttaaaa
accaattacaatctcagaatttcctacccagaacaccttaaaaaacaacagaaactcttt
ccaacaaaacatcaaatcgaagacttttggaatgaatgttttgtagacaaagagcatgac
ctgatccctagtatctctcctcatgctgaagagctttttacttactatagggaaaagaca
atcctattgcgtaatggattggacaaagatccgaaacattcaccttatacagtcacattc
tcttcctcaattttcgaagagagaccctatcatgaaagttaccttttcccgcctctttct
ttatctttccaaggaaatccggtccaaatccatggaacaattcatggggtatgcaatgag
ggactttatttatgttctatagatcctggagattccctaaaaaaaacaaccagaacccta
gggagtctcccagaaacctcttctgaacaaaaacagctcttagaaagatatgtagcgttg
gcggtgttacaaatgtctcagcacctctcttcagattcggctttaataaagcttacatcg
ttcaatactaaagaaaaccaccatcctcctttttcggatcctgaaggttatctccgtaaa
gttttagaagtctatcacctgatgtcttcgcaacccattcccctactttctccattatgt
tggaaaaccttagacgatgaagaaaaatttcatcaggcagtactttctgctataagtgaa
gaagctaaaaatccttctcttcctattttctggcagtttcacaatcgtaatatcgaggag
atcttaaatcacgtgggtgcatccgaacgtttgaaaattttatctcttttcagaggtccc
tgtgaagccgtttaa

DBGET integrated database retrieval system