KEGG   Chlamydia pneumoniae J138: CPj0752Help
Entry
CPj0752           CDS       T00032                                 

Gene name
recD_2
Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cpj  Chlamydia pneumoniae J138
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cpj03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
847925..849406
Genome map
AA seq 493 aa AA seqDB search
MHTEFAPFLEDLVHQQVISPLDIAFASKHISSDFEESFVFLAVSSALWRYGHPFLSLEEN
RIRPSLGGISETDLYRGFHNLPKEVRDKLFVVVSGRLYLRSLYTIRSKLLDKLSLLCSAT
PNYFPPSIDSSILSEEQNFIFNKITQGCFSIVSGGPGTGKTFLAAQLILSLVKQQPKLRI
AIVSPTGKATSHIRQILMKYNIFDDMVLMQTVHHFLQEYAYRRYNSIDVLLVDEGSMVTF
DLLYSLVQTLQGYEKDKKLYTSSLIILGDTNQLPPIGIGVGNPLQDLIGYFHENTFFLKT
SHRAKTGVVDQLTQSVLRGEMISFSPLPSISSAIEVLKNRFVKSLRQSEARLCVLTPMRH
GPWGVLNLNTMIHQRLARSDPDLRIPIMVTSRYETWGLFNGDTGLLCLKTQKLHFPQHEP
IDSRALSQYVYNYVMSVHKSQGSEYDEVIVIIPKGSEVFGVSILYTAITRAKYRVSVWGD
PETLHKIIKKSNY
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
ttgcacacagaatttgctccttttttagaagacttagtacatcagcaggtgatatcccct
ttagacatcgcttttgcttctaagcacatctcttcggactttgaagagtcttttgttttt
ctcgcggtctcctcagcgctttggcgttatggtcatccttttctttcccttgaggaaaat
cgcattagaccttctctaggagggatctcagaaacagatttgtatcggggatttcataac
cttcctaaggaagttcgagataaattatttgtcgttgtttcaggacgtttgtatttacgg
tctctgtatacgatacgatcgaaactcttagacaagctttcgttgctttgttcagcaacc
ccgaattattttcctccttctatagattcttcgatcctttcagaagagcaaaactttatt
tttaataaaataactcaaggatgtttttctatagtttctggaggcccaggaacaggaaaa
acttttttagctgcacaactcatcctctctttagtgaagcagcaacctaagttacgtatt
gctatagtatctcctacaggaaaggccacgtctcatattcgtcagattcttatgaaatat
aatatatttgacgacatggtgttgatgcagacggtgcaccactttcttcaggagtatgcg
taccgtcgctataactctatagatgtccttttagtagatgaaggctctatggtaactttt
gacttgttgtatagtttggtacaaaccctacagggatatgagaaagacaaaaaactttat
acctcgagtttaattattctcggagataccaatcaattgcctcctattggcattggggtt
ggaaatccccttcaagatctcataggatatttccatgaaaatacgtttttcctgaagaca
tcgcatagggcaaagactggagttgtggatcagctgactcaatctgtattgcgtggcgaa
atgatttctttttctcctctcccatcgatatcctcagctatagaagtcttgaaaaatcgt
tttgtaaagtcgttacgtcaatcagaagcacgtttgtgtgtattgactcctatgcgccat
ggcccttggggggttctgaacttaaacacaatgatacatcaaagattggcgagaagcgat
cctgatttacgtattcctattatggtgacgagtcgttatgaaacttggggactatttaat
ggagacacaggattactgtgtttaaaaactcagaaattgcatttccctcaacatgaaccc
atagattctagggctctatcacaatacgtctacaattacgttatgtctgtacacaagagc
caggggagtgaatacgatgaggttattgtaattattcccaagggaagcgaagtgtttggg
gtgtctattctctatactgcaattacccgagctaaatatagagtttcagtttggggagat
cccgagacgttacataagataattaagaagtctaattactag

DBGET integrated database retrieval system