KEGG   Chlamydia pneumoniae J138: CPj0759Help
Entry
CPj0759           CDS       T00032                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cpj  Chlamydia pneumoniae J138
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cpj00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:cpj00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
855809..856321
Genome map
AA seq 170 aa AA seqDB search
MCKNRGVRGIVACDPRGVIGLEGKLPWHYPEDLQFFSETIQKFPIVMGRKTWETLPRKYF
VDRAVVVFSHEKRQGVHGEIWVTSLEEFLLLDLSSPTFLIGGGELYSLFLENQIVRDFFI
SHIKKEYAGDTFFPLSLLETWTKTVLRDTQKITTCYYENHHSQNTKNISL
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaaaaatagaggggtccgcgggatcgtggcttgtgatcctagaggggtgataggt
ttagaaggaaagcttccttggcattaccctgaagatctccaatttttttctgaaaccata
caaaaatttcctattgttatgggaagaaagacttgggaaacacttcctaggaagtatttt
gttgatagagcagtcgtcgtgttttctcatgaaaaacgacagggagtgcacggggagatc
tgggtaacttctttagaagaattcctgctcttagatctttcttcgccgacatttttaatc
ggtggtggtgagctttattctcttttcttagaaaatcaaattgttcgagatttttttatt
tctcatatcaaaaaagaatatgctggtgatacatttttccctttgtccttgctagagaca
tggaccaaaactgtgcttagagatacccaaaagatcacaacgtgttactatgaaaatcac
cacagtcaaaacaccaaaaatatatccttatga

DBGET integrated database retrieval system