KEGG   Chlamydia pneumoniae J138: CPj0863Help
Entry
CPj0863           CDS       T00032                                 

Gene name
pgmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cpj  Chlamydia pneumoniae J138
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cpj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CPj0863 (pgmA)
   01230 Biosynthesis of amino acids
    CPj0863 (pgmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPj0863 (pgmA)
  Energy metabolism
   00680 Methane metabolism
    CPj0863 (pgmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CPj0863 (pgmA)
Enzymes [BR:cpj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CPj0863 (pgmA)
Exosome [BR:cpj04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CPj0863 (pgmA)
  Exosomal proteins of melanoma cells
   CPj0863 (pgmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(980149..980835)
Genome map
AA seq 228 aa AA seqDB search
MALLILLRHGQSVWNEKNLFSGWVDIPLSQQGIEEAFSAGRAIQNLPIDCIFTSTLVRSL
MTALLAMTNHHSKKIPYIVHEDPKAKEMSRIYSAEEENNMIPLYQSSALNERMYGELQGK
NKKQTAEQFGEERVKLWRRSYKTAPPQGESLYDTKQRTLPYFEKNILPQLQHGKNVFVSA
HGNSLRSLIMDLEKLSEEEVLSLELPTGKPVVYQWKNHKIEKHPEFFG
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggctcttcttattttattacgtcatggacaatctgtatggaatgaaaaaaatttattt
tctggatgggtagacattcctttaagccaacagggaattgaagaggctttttccgcagga
agagctattcaaaatttgcctatagactgcatctttacctctaccttagtacgtagtctg
atgaccgccttactcgccatgacaaatcatcactctaagaagatcccctatattgttcat
gaagatcccaaagcaaaagagatgtcgaggatctacagtgcggaagaagaaaacaatatg
attcctctctatcaatctagtgccctcaacgaaagaatgtacggcgaacttcaaggaaaa
aataaaaaacaaacagccgaacagttcggagaagagcgggtcaagctgtggaggcgcagc
tacaaaacagctcctcctcagggagaaagcctctatgatacgaaacaaaggaccttgcct
tactttgaaaaaaatattttgcctcaactgcaacatggaaaaaacgtttttgtttctgcg
cacggaaattccttacgctctttgattatggatctagaaaaattaagtgaggaagaggta
ctatctttagaattaccgacgggaaaaccagttgtatatcaatggaaaaaccacaaaatc
gaaaagcacccagaattttttggttaa

DBGET integrated database retrieval system