KEGG   Chlamydia pneumoniae J138: CPj0926Help
Entry
CPj0926           CDS       T00032                                 

Definition
thioredoxin
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
cpj  Chlamydia pneumoniae J138
Brite
Enzymes [BR:cpj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CPj0926
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1057408..1057908
Genome map
AA seq 166 aa AA seqDB search
MKFWLQGCAFVGCLLLTLPCCAARRRASGENLQQTRPIAAANLQWESYAEALEHSKQDHK
PICLFFTGSDWCMWCIKMQDQILQSSEFKHFAGVHLHMVEVDFPQKNHQPEEQRQKNQEL
KAQYKVTGFPELVFIDAEGKQLARMGFEPGGGAAYVSKVKSALKLR
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttggttgcaaggatgtgcttttgtcggttgtctgctattgactttaccttgt
tgtgctgcacgaagacgtgcttctggagaaaatttgcaacaaactcgtcctatagcagct
gcaaatctacaatgggagagctatgcagaagctcttgaacattctaaacaagatcacaaa
cctatttgtcttttctttacaggatcagactggtgtatgtggtgcataaaaatgcaagac
cagattttgcaaagctctgagtttaagcattttgcgggtgtgcatctgcatatggttgaa
gttgatttcccccaaaagaatcatcaacctgaagagcagcgccaaaaaaatcaagaactg
aaagctcaatataaagttacaggattccccgaactggtcttcatagatgcagaaggaaaa
cagcttgctcgcatgggatttgagcctggtggtggagctgcttacgtaagcaaggtgaag
tctgctcttaaactacgttaa

DBGET integrated database retrieval system