KEGG   Chlamydia pneumoniae J138: CPj0954Help
Entry
CPj0954           CDS       T00032                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cpj  Chlamydia pneumoniae J138
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpj00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CPj0954
Enzymes [BR:cpj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     CPj0954
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1087635..1088060
Genome map
AA seq 141 aa AA seqDB search
MQYFSPAKLNLFLKIWGKRFDNFHELTTLYQAIDFGDTLSLKNSMKDSLSSNVNELLSPS
NLIWKSLEIFRRETQIHQPVSWHLNKSIPLQSGLGGGSSNAATALYALNEHFQTHIPITT
LQLWAREIGSDVPFFFLQEQH
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgcaatacttttctcccgcaaagttaaacctttttttaaaaatatggggaaagcgtttc
gataattttcacgagctcacaaccctttatcaagctatagattttggagacacactttct
ttaaagaatagcatgaaggatagtttgagcagtaatgttaacgaattgctttccccctcg
aatctcatctggaaaagcctcgaaattttcagaagagaaacacaaattcaccaaccagtt
tcttggcacctcaataaatctattcccctccagtctggcttaggaggaggcagtagtaat
gcagccacagccctctacgctcttaacgagcatttccaaacccatattcctataacaaca
ttgcaactttgggctcgagaaatcggaagcgatgttccttttttttttcttcaggaacag
cattag

DBGET integrated database retrieval system