KEGG   Chlamydia pneumoniae J138: CPj0955Help
Entry
CPj0955           CDS       T00032                                 

Definition
hypothetical protein
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cpj  Chlamydia pneumoniae J138
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:cpj00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1087994..1088527
Genome map
AA seq 177 aa AA seqDB search
MATLGSRNRKRCSFFFSSGTALGKGRGEHLFSIKKLNHKHKYVLYLDHQGIPTEKAYQSL
LPQDYSTGNHNACFYGENDLEKSVFRIRTDLKNKKHMLERMWSPFESHVLMSGSGATLFV
CYLEELEQDSKVSSQIHSLIKQTQGIPVSRLYREPHWYSLKQSTYKNSPLECFQPQI
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
attgcaactttgggctcgagaaatcggaagcgatgttccttttttttttcttcaggaaca
gcattagggaaaggtcggggagaacacctcttctctataaaaaaactcaaccataaacat
aaatatgttctctatctcgatcatcaaggaatacccacagaaaaggcataccaatcctta
cttccacaagactatagtacaggaaatcataacgcctgtttctatggtgaaaatgatcta
gaaaaatccgtatttcgtatacggacagacttgaaaaataaaaaacacatgttagagagg
atgtggagtcctttcgaaagccatgtgcttatgtcaggttcaggagctaccctattcgtt
tgttatctagaagagttagaacaagattcaaaagtatcctcccaaatccatagcctaatc
aaacaaacccaaggaattcccgttagccgtctttatagggaaccgcattggtattctcta
aagcaatctacttacaaaaacagcccgctagagtgttttcagccacagatatga

DBGET integrated database retrieval system