KEGG   Chlamydia pneumoniae J138: CPj1038Help
Entry
CPj1038           CDS       T00032                                 

Gene name
aroL
Definition
shikimate kinase (EC:2.7.1.71)
Orthology
K00891  
shikimate kinase [EC:2.7.1.71]
Organism
cpj  Chlamydia pneumoniae J138
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cpj01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cpj00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1188599..1189129)
Genome map
AA seq 176 aa AA seqDB search
MTIILCGLPTSGKSSLGKALAKFLNLPFYDLDDLIVSNYSSALYSSSAEIYKAYGDQKFS
ECEARILETLPPEDALISLGGGTLMYEASYRAIQTRGALVFLSVELPLIYERLEKRGLPE
RLKEAMKTKPLSEILTERIDRMKEIADYIFPVDHVDHSSKSSLDQASQDLITLLKS
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgacaattattctatgtggtctacccacaagcggaaagtcttcgctcgggaaagctttg
gctaaatttctaaaccttcctttttatgatcttgatgatttaattgtaagcaactacagc
agtgcactatactcctcatctgcagagatctataaagcttatggggatcagaaattcagt
gaatgtgaagctcgtattcttgaaactttacctccagaagatgccttgatctcccttggt
ggagggaccttgatgtatgaagcctcttaccgagcgattcaaactaggggagctcttgta
tttctctctgtagaactacctttaatttatgaaagactcgagaaacgagggttaccagaa
cggctgaaagaagccatgaaaacaaaacctctaagcgagattttaactgagcgcatcgac
agaatgaaagaaattgctgattacatttttcccgtggatcacgtagatcattcctcgaag
agctccttagatcaagcgtctcaagatctcattaccttgttaaagtcatga

DBGET integrated database retrieval system