KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_0001Help
Entry
Cp1002_0001       CDS       T01876                                 

Gene name
dnaA
Definition
(GenBank) Chromosomal replication initiation protein
  KO
K02313  
chromosomal replication initiator protein
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:cpk00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Cp1002_0001 (dnaA)
DNA replication proteins [BR:cpk03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    Cp1002_0001 (dnaA)
Chromosome [BR:cpk03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    Cp1002_0001 (dnaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1..1812
Genome map
AA seq 603 aa AA seqDB search
MSEAPSTWNERWQEVTNELLSQSQDPESGISITRQQSAYLRLVKPVAFVEGIAVLSVPHA
RAKKEIETTLGPVITEVLSRRLGRQYSLAVSVHAPEENPEVSSATPDAVSDYQEQSAVSG
QYGATSANADFQNQQSTIYRKPQESQYPVTFGASSYGNEKYQENSQDQGISHHPYGFNEA
QRIASSASHAVPQSGSELLHDPVHTRRTDAALDQNYPGNTGGWRTEHIQEPMPTEQIPSG
TPRTREQPSFNPDRALALNPHYTFDSYVVSDSNKLPCSAAIAVAEKPARAYNPLFIWGDS
GLGKTHLMHAVGNYAQYLNPRLRIKYVSSEEFTNEYINSVRDDRQEAFKRKYRELDILMV
DDIQFLQGKEGTQEEFFHTFNALYQANKQIVLSSDRPPKQLTTLEDRLRTRFQAGLIADI
YPPDLETRIAILMKKAASESIVADREAIELIASRFNTSIRELEGAFIRVSAYASLMSPDK
GKHRVDLRIAEKALEDMMPEQANEEITATTILAATAEYFEMDVNALKGSGKTRAVAHARQ
LAMYLCRELTDLSLPKIGEQFGGKDHTTVMYADRKVRKEITEKKETYDEIQLLTQQIKSS
SRG
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggaggctccatcgacatggaacgagcggtggcaagaagttactaatgagctgctg
tcacagtctcaggacccggaaagtggtatttccattacgcgacagcaaagcgcctacctg
cgtctggttaaaccagttgcttttgtagagggtattgccgttttaagcgttcctcacgcc
cgagcgaaaaaagagattgaaactacgctgggacctgttatcacagaggtattgtctcgt
agactaggtcgacaatacagtcttgcagtgagcgttcatgctccagaggaaaatccagaa
gtatcctcggccactccagatgctgtgtctgattaccaggaacaatctgcagtttctgga
caatacggagcaacttcagccaatgctgacttccagaatcaacaaagcacgatatatcgc
aagccacaggagtcgcagtatcctgtgacttttggtgcttcttcatacggaaatgagaag
taccaggaaaattcccaagaccagggcatttctcatcatccttatggttttaatgaggct
caacgcattgcttcatctgcctctcatgctgttccgcaaagtggttctgagctactgcac
gatcctgttcacacacgcaggacagatgctgccctagaccaaaattatccgggaaatacc
ggggggtggcgtactgagcatattcaggaacccatgcctactgagcagattccttccggc
acgccgcgtactcgtgagcagccatcgtttaacccggatcgtgcgctagcgctgaacccg
cactacacatttgattcttatgtggtcagcgattccaataagttaccctgctcagcagcg
attgctgtagcagaaaagccagcccgtgcttacaatcctctttttatttggggagactca
ggtttaggcaaaacccaccttatgcatgcagtgggtaactacgctcaatatttaaatccg
cgtcttcgcattaaatatgtttctagtgaggaattcactaatgaatatatcaattcagtg
cgagatgacaggcaggaagcattcaagcgtaaatatcgtgaactagatatcttgatggtc
gatgatattcagttcctccagggaaaagaaggaacccaggaagaattttttcatacgttt
aatgcgctgtatcaggcaaataaacagattgttttatcctcagacaggcctccgaaacag
ctgactaccttggaagatcggctacgtacgcgattccaggctggccttattgcagatatt
tacccgccagatttagaaactcgaattgcgattttgatgaagaaggcggcgtcggaaagc
attgttgctgatcgtgaggctatcgagctgatcgcgagccgttttaatacgtcgatccgc
gaattagaaggcgcttttattcgtgtttccgcgtatgcctcgctgatgtctccggataag
ggtaaacaccgtgttgatctgcggatagccgaaaaagcactcgaagatatgatgccggaa
caagcaaatgaagagattacggcaacgactatccttgcagctactgccgagtactttgag
atggatgttaatgcgctcaaaggcagtggtaagactcgtgcagtcgcgcacgcgcgtcag
ctagcgatgtacctttgccgcgagcttacagatttatcgctgcctaagatcggtgaacaa
tttggcggtaaagaccacaccacggtgatgtatgcggatcgaaaggttcgtaaagaaatc
accgagaagaaagaaacttatgatgagattcagctgctcacgcagcagattaagagttct
tctcgcggataa

DBGET integrated database retrieval system