KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_0275Help
Entry
Cp1002_0275       CDS       T01876                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cp1002_0275 (hemD)
Enzymes [BR:cpk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Cp1002_0275 (hemD)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Cp1002_0275 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
287383..289071
Genome map
AA seq 562 aa AA seqDB search
MSSTPQPTPVTPAPEGKVIFVGAGPGNPDLLTVRAREVLSHTAFAVVDAEVLPGVRSVVA
RELDVPMDKVQAAEEEYERLCAEAKEAGARRKPQRPDAPTAAEITEVDDDVPVVEVVEKL
KELLSSGEDVIRLVQGNPLSCDRTLEEISAVKQAGLEFHVVPGMSLPATVPAFAGIALGS
SYTETDVTGEDVDWEQLAAAPQPLVLQATKEDLPTIAAELKSRGIEASTPVTVTARGTTR
LQRSFDISLGALHKLDGDLAGTLVVTLGKAADERTKYSWWENRSLFGWRVLVPRAKEQAG
SMSALLAAQGAIPQEVPTISVEPPRNPAQMEKAVKGIVEGRYQWVIFTSVNAVKSVREKI
GSFGLDARAFAGVRIGAVGTKTAKAIRELGITPELLPPRNRQNAAGLVSVFPEYVEDLDP
VGRVLLPRADIATDVLVEGLEGLGWEVDDVVAYRTVRAAPPSAEVRDMIKSGGFDAVCFT
SASTVKNLVGIAGKPHQRTIIACIGPMAAAAAKELGLRVDVIPEVADVPHLINGLATHVA
QLRAAGQLPPPRKKRRARKNRE
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgactccgcaacccaccccggtaacccctgcaccggagggaaaagtgatcttt
gtaggagcaggaccaggaaaccctgatctgctcaccgttcgcgcccgcgaagttctcagc
cataccgcttttgccgtagtagatgcagaagttctaccgggggttcgctcagtggttgca
cgtgaactcgatgtgccgatggataaagttcaggcggctgaggaagaatacgagcggctg
tgcgcggaagcaaaagaagctggtgcgcgccgtaaaccgcagcgcccggacgccccgact
gccgctgagattacagaagtagacgacgacgttcctgtagtagaggtagtggaaaagctt
aaggagcttttgtccagcggggaagacgttattcgcctggtgcagggaaaccccttgtca
tgtgaccgaaccctggaagaaatttctgcggtcaagcaggccggactggagttccacgtg
gttcccggcatgtccttgccggcgaccgttcctgcttttgcgggtatcgctctgggctct
tcttatacagaaaccgatgtaactggggaagacgtagattgggaacagcttgctgcagca
cctcagccgctggttttgcaggcaactaaagaggatctgcctacaatagccgcagagtta
aaatctcgtgggatagaggcatcgaccccggtgacggtgacagctcgcgggacaacacgc
ttgcaaagaagttttgatattagtttgggcgccctgcacaagttggacggggacctcgcc
ggaaccctcgtggttactttaggcaaagcagcggatgaacgtaccaagtattcttggtgg
gagaaccgttcgctctttggttggagagtgctggtcccccgtgcaaaagaacaagccgga
tcaatgagtgcattgttggctgctcagggggcaatcccgcaagaagttcccacaatctct
gtggagccgccacgtaatcctgcgcaaatggagaaggccgttaaagggatcgtggaaggc
cgctaccaatgggtgatttttaccagcgtcaacgcagtgaaatccgtgagagagaaaatc
ggttccttcggactcgatgctcgtgcctttgctggcgtgcgcattggagcggtaggaaca
aaaactgctaaggccatccgtgagcttggaatcacgccggagttgctccctccgagaaat
cggcaaaacgctgcaggtttagtgtcagtgttcccggagtatgtggaagaccttgatcca
gtcggacgggtcctcttgccccgggcggatattgcaacggacgtcctggtggaaggctta
gaaggccttggctgggaggtcgacgatgtggtggcgtatcgcacggtacgggccgccccg
ccgagtgcagaagtgcgcgacatgattaaaagtggcggttttgacgctgtgtgctttacc
tctgcatccacggtaaaaaatctggtgggcattgctgggaaaccacatcagcgcacaatc
attgcatgcattggtccgatggcggcggcagcggcaaaagaattaggcctgcgggtggac
gtgatccccgaggtagcggatgttcctcacttgattaatggtcttgctacccacgtggca
caactgcgcgcagctggccagctgccgcctcctaggaagaagcggcgcgcccgaaaaaat
cgcgagtaa

DBGET integrated database retrieval system