KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_0781Help
Entry
Cp1002_0781       CDS       T01876                                 

Gene name
folP
Definition
Dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cp1002_0781 (folP)
Enzymes [BR:cpk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Cp1002_0781 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
826440..827297
Genome map
AA seq 285 aa AA seqDB search
MPRSAFLGTEGLATVMAIVNRTPDSFYDHGATHAFDAAIKRAGAVIAAGAGIVDIGGVKA
GPGEFVSISEEIDRVVPVIAAVHEAFPETIISVDTWRAKVAELAVDAGAALINDTWAGYD
PELVEVAGDRRVGYICSHTGGVVPRTRPYRVHYDDVVHAVIDETTRQAEHAVSLGVPEDK
IFIDPTHDFGKNTFHGLELLRRIDEIVATGWPVLMALSNKDFIGETLARNVDKRVPGTLA
ATAWSAERGVAAFRSHQVEETIDVIRMTAAIQGTVSPLKTTRGLA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgcctaggagcgccttcctaggcactgaaggcttagctacggtgatggcgatcgtaaat
aggacgcccgattccttttacgatcatggtgcaactcatgcttttgatgccgcaatcaag
cgtgcaggagcagtgattgcagccggtgccgggatcgtggatatcggtggggtcaaagcc
gggccaggtgagtttgtttccatttctgaagaaatagaccgtgtggtgccggtgatcgct
gcggtgcacgaggctttccccgagacaatcatttcggtggatacctggcgcgcaaaagtc
gccgagttagccgtcgacgcaggcgccgcgctcatcaacgacacctgggccggttacgat
ccagaactcgtagaagtcgctggagatcgtcgagttggatatatctgctcacacaccggc
ggcgtggtccctaggacaaggccgtatcgcgtgcattacgacgacgtggtgcatgcggtt
atcgatgaaaccacgcggcaagcggagcacgcagtgtccctaggagtaccagaagacaag
atattcatcgaccccactcatgactttggcaaaaacaccttccacgggcttgagcttcta
cgacgaatcgacgaaatcgtggccaccggatggcctgttctcatggctctgtccaataaa
gattttattggagaaacgcttgctcggaacgtcgataagcgagtgcctggcactttggcg
gcaacagcatggtctgcggagcgaggcgtggcggcgtttcgttcgcatcaagtggaagaa
acaattgacgtgattcggatgactgcggcgattcaaggaacggtttctccgctgaaaaca
actagaggtttggcgtga

DBGET integrated database retrieval system