KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_1104Help
Entry
Cp1002_1104       CDS       T01876                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Pathway
cpk00010  Glycolysis / Gluconeogenesis
cpk00051  Fructose and mannose metabolism
cpk00562  Inositol phosphate metabolism
cpk01100  Metabolic pathways
cpk01110  Biosynthesis of secondary metabolites
cpk01120  Microbial metabolism in diverse environments
cpk01130  Biosynthesis of antibiotics
cpk01200  Carbon metabolism
cpk01230  Biosynthesis of amino acids
Module
cpk_M00002  Glycolysis, core module involving three-carbon compounds
cpk_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cpk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cp1002_1104 (tpiA)
   00051 Fructose and mannose metabolism
    Cp1002_1104 (tpiA)
   00562 Inositol phosphate metabolism
    Cp1002_1104 (tpiA)
Enzymes [BR:cpk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Cp1002_1104 (tpiA)
Exosome [BR:cpk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Cp1002_1104 (tpiA)
  Exosomal proteins of bladder cancer cells
   Cp1002_1104 (tpiA)
  Exosomal proteins of melanoma cells
   Cp1002_1104 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADL20989
Position
complement(1205279..1206058)
Genome map
AA seq 259 aa AA seqDB search
MERKPLIAGNWKMNLDHMQAVATVQKLAFALPAEYYEKVDVAVTVPFTDLRSVQTVIDGD
KLQITYGAQDVSEHESGAYTGEISAAMLAKLGCTWVVVGHSERREYHGESSKLVAAKAKA
ALSKDISPIVCVGEPLTIREAGTHVDFVVEQTRESLAGLTEDELAKTVIAYEPVWAIGTG
KVASAADAQEVCKAIRGLIKELANEKIAAGIRILYGGSVKEETVAEIVGQPDVDGGLVGG
ASLDGEAFAKLAANAATGL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggaacgtaagccgctcatcgccggtaactggaagatgaatttagaccacatgcaagct
gtggcaacggttcagaagttagcgtttgcacttcctgccgaatactacgagaaagtggat
gtcgcagttactgtaccgttcacagatctacggtctgtccagactgtgattgatggagat
aaacttcagatcacgtacggcgcccaagatgtatcagagcatgaatcgggcgcttacact
ggagaaatctctgcagctatgcttgcaaagcttggctgtacatgggttgtggtggggcac
tcggagcgccgtgagtaccatggtgaatcttcgaaacttgttgcggcgaaggctaaagca
gcactgagcaaagatataagccctatcgtttgcgtcggtgagcccctaacgatccgggaa
gcaggaactcacgtagatttcgtcgtggagcaaacccgtgagtcgcttgcaggcctgacc
gaagacgagcttgctaagaccgttatcgcttatgagccggtttgggcaatcggtaccggg
aaggttgcttctgctgctgatgcccaagaggtgtgtaaagcaatccgcggtttgattaaa
gaacttgccaacgagaaaatcgccgcaggaattcgtatcctgtatggcggttctgtaaaa
gaagagacagtagcagagatcgtcggacaacccgatgtagatggtgggcttgtcggcggt
gcttctcttgatggcgaggcatttgccaagcttgcagctaatgcagctaccggtctttaa

DBGET integrated database retrieval system