KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_1124Help
Entry
Cp1002_1124       CDS       T01876                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cpk00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Cp1002_1124 (gmk)
Enzymes [BR:cpk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Cp1002_1124 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1227699..1228274)
Genome map
AA seq 191 aa AA seqDB search
MTGDNPKGRLVVLAGPSAVGKSTVVHRLREEVPNLYFSVSMTTRAPRPGEVDGVDYFFVT
PEEFQSRIDGGEMLEWAEIHGGLQRSGTPAGPVEDALLAGRPVLVEVDLIGARNVAALKP
DAETVFLAPPSWEVLVDRLTGRGTEPEDVIKRRLETARQELASQDEFKHVVTNDKVDKTV
AEIRDILLGCC
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgacaggcgataacccaaaaggtcggctagtcgttttagctggtccatctgctgtggga
aagtccacggtggttcatcgccttcgcgaggaagtaccaaacctatattttagtgtctcg
atgaccacgagggctcctcgtcctggtgaagtcgatggtgtggattatttcttcgtgact
cccgaggagtttcagtctcgtatcgacggtggagaaatgctcgagtgggcagagatccat
ggtggactgcagaggtctgggactcccgcggggcctgtggaagacgcgttattggccggt
cgtcctgtgctggttgaagttgatcttattggtgctcgtaacgtcgcggcgttgaagcct
gatgcagagaccgttttcctagctccgccgtcatgggaagtccttgtagatcgtcttact
gggcgaggaacggagcccgaagacgtgatcaagaggcggctggaaactgcacggcaggag
ctagcatcccaggatgagtttaagcacgttgtaaccaacgataaagttgataagacggtc
gctgagattcgggatattctgctcgggtgctgctaa

DBGET integrated database retrieval system