KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_1204Help
Entry
Cp1002_1204       CDS       T01876                                 

Gene name
ppgk
Definition
(GenBank) Polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Pathway
cpk00010  Glycolysis / Gluconeogenesis
cpk00520  Amino sugar and nucleotide sugar metabolism
cpk01100  Metabolic pathways
cpk01110  Biosynthesis of secondary metabolites
cpk01120  Microbial metabolism in diverse environments
cpk01130  Biosynthesis of antibiotics
cpk01200  Carbon metabolism
Module
cpk_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cpk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cp1002_1204 (ppgk)
   00520 Amino sugar and nucleotide sugar metabolism
    Cp1002_1204 (ppgk)
Enzymes [BR:cpk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Cp1002_1204 (ppgk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ADL21087
Position
1316886..1317662
Genome map
AA seq 258 aa AA seqDB search
MPFSKLKFMTRIGFGIDVGGSGIKGARVDLDTGDFVGDRIKILTPKPATPEAVAQTISRI
VAEAEWEGPVGITLPSVIRNQVALSAANIDQSWINVDVQKLFTKTLGGRNIAVLNDADAA
GIAEVAFGEDQARRGSAILLTLGTGIGSAFFINGVLFPNTELGHMIVEGKEAEHLASSAA
KDRDELSYSKWAKRVSKVLSEYERLFWPDVFIVGGGISRKADKWVPKLTIDTPVIPAKLR
NTAGIVGAAMAADQNIRP
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtgccattcagtaagctcaagttcatgacacgaattggctttggcattgatgttggcgga
tctgggattaaaggtgcccgcgttgatctggataccggtgattttgtcggagatcggatc
aaaattttaacccccaagcctgccacccccgaagcggtcgcccaaacgatttctcgcatt
gttgcagaggccgaatgggaaggacccgtcggaataacgctgccttccgtaatccggaat
caagtagcactttctgccgccaacattgaccaatcatggatcaatgttgatgttcaaaaa
ttatttaccaagaccctgggcgggcgtaacatcgcagtgcttaacgacgccgatgcggcg
ggcatcgccgaggtagccttcggagaagatcaagctcgacgtggttccgccattttgctc
actctaggcactgggatcggttccgctttctttatcaacggggtcttattccccaacacc
gagttagggcacatgatcgtagagggaaaggaagccgagcatctagcttcatctgcagca
aaagatcgcgatgagttgagctattccaaatgggccaagcgcgtttctaaagtcctcagc
gaatacgaacgacttttttggccagacgtttttatcgtaggcggtggtatctcacgcaaa
gctgataaatgggtacccaaactcactatcgatacgcccgtcatacctgcaaaactacgt
aataccgcaggtatcgtaggagcagcaatggcggcagaccaaaatatcaggccttag

DBGET integrated database retrieval system