KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_1348Help
Entry
Cp1002_1348       CDS       T01876                                 

Gene name
trpC2
Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Pathway
cpk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpk01100  Metabolic pathways
cpk01110  Biosynthesis of secondary metabolites
cpk01130  Biosynthesis of antibiotics
cpk01230  Biosynthesis of amino acids
Module
cpk_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpk00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cp1002_1348 (trpC2)
Enzymes [BR:cpk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Cp1002_1348 (trpC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE FMN_dh OMPdecase QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ADL21225
Position
complement(1482027..1482848)
Genome map
AA seq 273 aa AA seqDB search
MGRVRPSVFEEIIAGVIEDVAARESVVSFKEIKARSRACEPPRDAIAALLNSGCGVIAEI
KRAAPDKGVLAEINSPVGLAKELVAGGASLIACQTERRRFHGSLSEMAEIRNVISVPIMC
RDFIVDPYQIHEARCYGADMVPLRVAALDQARMIALIDRIESLGMAALVEVRDTEEASRA
VAAGAKIIGVNARDFSTMTLNRLAFAEIAPGLPTDVIRVALSGVRNARELLDYAASGADA
VVVGEKIVTAADPCEATRSLVAAGQHPSCPSRG
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgggacgggttaggccatcagtcttcgaagagattattgcgggcgtcattgaagatgta
gctgcgcgagaatcagtggtgtcgtttaaagagatcaaagcccgttcgcgtgcttgcgag
ccgcctcgggatgcaatagcggcgcttcttaatagtggttgtggcgtgatcgctgagatt
aaacgtgctgccccagataaaggcgttttagcagagatcaattctcctgttggcttagca
aaagaacttgtcgccgggggcgctagtttgattgcgtgtcagacggaacggcgaaggttc
cacggttcattatctgagatggctgagattcgtaatgtgatatcggtgccaataatgtgc
cgagacttcatcgtggatccctatcaaattcatgaggcgcgctgttatggagcggacatg
gtgcccttgcgcgtagctgctttagaccaagccaggatgattgcgcttatagatagaatc
gagtccctgggaatggcagcgctggtagaagtccgggatactgaggaagcatcgcgtgcg
gtggcagcgggtgcgaagatcataggggtaaacgcccgggatttctcaacgatgacgctc
aaccgcctggccttcgcagaaattgctcctggacttcccacagatgttattagagttgca
ttgtccggtgtgcgcaatgctcgtgaactcctggattacgctgcctctggtgcggacgcg
gtggttgtgggagaaaaaattgttactgctgcggatccgtgcgaagcgacgcgttcgttg
gtggcagcaggccaacatccatcgtgtccatcgcgaggataa

DBGET integrated database retrieval system