KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_1891Help
Entry
Cp1002_1891       CDS       T01876                                 

Gene name
adhA
Definition
Alcohol dehydrogenase GroES-like protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:cpk01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cpk00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:cpk00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:cpk00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:cpk00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:cpk00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2071195..2072232)
Genome map
AA seq 345 aa AA seqDB search
MKTDFPEAFTAAVVDNFGPELNIHDVVLPEPGPNQALVKLVASGICHTDLHAAEGDWPVK
PEPPFVPGHEGVGEVVKLGPGHHRVQLGDMVGNVWLWSACGECEYCRTGRETLCNDAEYG
GYTVDGSFGEYMLVDTRYCARIPEGSDPVEVAPILCAGVTVYKGLKETECKPGQYMVISG
IGGLGHIAVQYAVAMGMRVIAVDIADEKLELARKHGAEFAVNALKEDPVESINAFTSGGA
HGVLVTAVHPQAFGQAIGMARKGGTIVFNGLPPGEFPAPIFEIVFKGLTIRGSLVGTRQD
LEEALDFYARGMIKPTVTECKLGDVNSVFADMHKGTVDGRMAIRY
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaccgatttccctgaggccttcaccgccgctgtagttgacaactttggccctgaa
ctcaatatccacgatgttgttttgcccgagccgggacctaatcaggcattggtaaagctg
gtggcctctggtatttgccatacagatcttcatgcggcggaaggggactggccggtaaaa
ccggaaccgccttttgtccccgggcatgaaggcgtgggggaagttgtgaaattgggaccc
ggccatcatcgcgtgcaacttggagacatggtgggcaacgtttggctttggtccgcctgt
ggggagtgcgagtactgccgcaccggacgtgaaaccctttgcaatgacgccgaatatggc
ggctatacggtcgacggctcttttggtgaatacatgctggtagatacccgctactgtgcg
cgtattccagaaggctccgatccagttgaagtggcccccatcttgtgtgccggcgtgacc
gtgtacaaaggcctcaaagaaaccgagtgtaagccgggccagtacatggtgatttccggc
atcggtggcctagggcatatcgctgtgcagtatgcggtggctatgggaatgcgagtgatc
gctgtggatattgcagatgagaagctcgagctggcgcgtaagcacggtgcagaatttgca
gtcaatgcgttgaaggaagacccggttgagtcgatcaacgcatttacctcaggtggtgcg
catggcgttttggtcactgccgtgcacccgcaggcgtttggacaagccatcgggatggcc
agaaaaggcggaaccatcgtatttaatgggcttcctccaggagagttcccggcaccgatt
tttgagattgtgttcaaggggttaactattcgcggttcattggtgggaacgcgccaggac
ctagaagaagccctggatttctatgcacgcggaatgatcaaaccgaccgttacggaatgc
aagcttggcgacgtcaacagtgtcttcgccgatatgcataaaggcacggttgatggtcgc
atggctattaggtattaa

DBGET integrated database retrieval system