KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_1991Help
Entry
Cp1002_1991       CDS       T01876                                 

Gene name
ldh
Definition
(GenBank) L-lactate dehydrogenase
  KO
K00016  
L-lactate dehydrogenase [EC:1.1.1.27]
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Pathway
Glycolysis / Gluconeogenesis
Cysteine and methionine metabolism
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cpk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cp1002_1991 (ldh)
   00620 Pyruvate metabolism
    Cp1002_1991 (ldh)
   00640 Propanoate metabolism
    Cp1002_1991 (ldh)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Cp1002_1991 (ldh)
Enzymes [BR:cpk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     Cp1002_1991 (ldh)
Exosome [BR:cpk04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   Cp1002_1991 (ldh)
  Exosomal proteins of breast milk
   Cp1002_1991 (ldh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2202043..2202993)
Genome map
AA seq 316 aa AA seqDB search
MKDIVGNKVVLIGAGDVGVAYAYALVNQGTVDHLAIIDIDEKKLEGNVMDLNHGVVWASS
RTKVTKGSYADCEDAAMVVICAGAAQKPGETRLQLVDKNMKIMKSIVDEVMANNFDGILL
VASNPVDILAYAAWKYSGLDWHRVIGSGTVLDSARFRYMLGERYEVAPSSIHAYIIGEHG
DTELPVLSSATVAGVSMRRQLEKNPGLDAELEKIFEETRDAAYAIIDAKGSTSYGIGMGL
ARITRAVIHNQEVALPVSALLQGEYGQENIYIGTPAVINRGGINRVVELELTDHEMERFT
HSANTLRDIQEQFFPV
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatatcgtcggaaacaaagttgtgctcattggcgcaggtgatgttggggttgcg
tatgcgtatgcgctagttaatcaggggaccgtcgatcatctggccattattgatattgat
gagaaaaagcttgagggcaacgtcatggacctcaaccatggcgttgtgtgggcttcctcc
cggaccaaagtcacaaaaggcagctacgcggactgtgaagacgccgctatggttgtgatc
tgtgcaggggctgcgcaaaagcccggtgaaacccggctgcagctcgtggataagaacatg
aagatcatgaagtccatcgtggacgaggttatggccaataactttgatggcatccttctt
gtcgcctctaatcccgtggatatccttgcttatgccgcatggaaatattcaggactggat
tggcatcgggtgatcggttcaggaacggtcctcgactctgcccgcttccgctatatgctt
ggcgagcgctatgaagtcgctcctagctcgattcacgcttatattatcggcgagcatggc
gatacagagctcccggtcctttcctcggctaccgtcgcgggcgtatccatgcgccgacag
ctggagaaaaaccctggattggatgctgagctggagaagatattcgaggaaacccgcgat
gccgcttacgccattatcgacgccaaaggttctacctcttatggcattggcatggggctc
gcccgcatcacgcgcgcggtaatccataaccaagaggttgcactccctgtgtcggctctc
ttgcaaggagaatatgggcaggagaacatctatattggcaccccagcggtgattaaccgg
ggtggcattaaccgggtggttgaacttgaattgaccgatcatgagatggagcgcttcacg
cactccgccaataccttgcgagacatacaagaacagttctttcctgtataa

DBGET integrated database retrieval system