KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_1995Help
Entry
Cp1002_1995       CDS       T01876                                 

Definition
(GenBank) Hypothetical protein
  KO
K08224  
MFS transporter, YNFM family, putative membrane transport protein
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Brite
Transporters [BR:cpk02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Acriflavin-sensitivity (YnfM) family [TC:2.A.1.36]
    Cp1002_1995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
2205890..2207101
Genome map
AA seq 403 aa AA seqDB search
MSPPVPLPASGREGLRRGSTDYRRAVLASLAAGLATFNALYCTQAILPTLVTSLNVSPTT
AALTISATTGALAICIVPISIFSERFGRGRVLVISALLATMLGLCLPLAHSIWVLIALRA
IQGIFIAGVPAVAMAWLSEEIHHEDLAKAMGIYIAGNTVGGLSGRLTPALLLDITTWRWA
LFATTLCALIMAITMAVMLPQQRRFQPRTLSIKHELTTMLAHWTTPSLSLLFATAFIGLG
ISVSVYNYIGFRMIHTFQLSEALVGTVFLMYLAGTWSSARAGIWAGRIGRGRGMMYGALA
MLLGLALMLWNSLTITLIGLFIFTAAFFLIHSIASGWVGLIATTHRAAGASMYLLSYYVG
SSVVGWLSGYAFDALSWHGFIGWLSLWTIALLGIAVALRRLAT
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtctccgccagtgccattgcctgcctctgggcgggaagggttacgccgaggtagcacc
gactaccggagagccgtactcgcctccctagccgcagggcttgccacattcaatgctttg
tattgcacgcaagctattctccccacgcttgtaacaagtttgaatgtaagccccacaacg
gccgcgctcactatttccgccacaacaggggccttagcaatttgcatagttcctatttct
atcttctcggaacggtttgggcgtggacgagtccttgtcatctctgcgcttttggccaca
atgctgggattgtgccttccgttagctcactctatatgggtccttatcgcgcttcgcgcc
attcagggaattttcattgctggagtcccggcggtggcaatggcgtggcttagcgaagaa
atccaccacgaggacctggccaaggccatgggaatctatattgcaggcaatacggtagga
gggctctccggccggctgacccccgcgctgctcctcgatatcaccacatggcgatgggct
ctgtttgctaccaccctgtgcgccctcatcatggctataactatggcagtcatgttgcct
caacagcgtcggttccaaccacggaccttaagcataaagcatgagctcacaacgatgctc
gcacactggaccacgccctccctgtcactattatttgctactgcttttatcggcctcggc
atttccgtttcggtgtacaactacatcggattccgcatgatccatacattccagctttcc
gaggctttggtaggcactgtattcctcatgtatttggcaggaacctggagttccgctcgc
gcaggcatttgggccgggcgcatagggcgcggtcgaggaatgatgtatggagcgcttgcc
atgctattaggcctagccctcatgctctggaactcccttacgatcacgcttataggactg
ttcatattcacagcagcgttcttccttatccattccattgcatccggctgggtgggttta
atagctacaacgcaccgagcagcgggcgcaagtatgtatctgctcagttattacgttggg
tcttccgttgtgggatggctatctggttatgcttttgacgcgctgagctggcatggtttt
atcggttggctcagcctgtggaccatagcgcttttaggcatcgcagttgctttacgacgc
ctcgcgacctga

DBGET integrated database retrieval system