KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2003Help
Entry
Cp1002_2003       CDS       T01876                                 

Gene name
tcsR
Definition
(GenBank) Two-component system transcriptional regulatory protein
Organism
cpk  Corynebacterium pseudotuberculosis 1002
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2216075..2216713)
Genome map
AA seq 212 aa AA seqDB search
MIRVLLADDHEIVRLGLRAVLESADDIEVIGEVATAEGAIAAAQAGGIDVILMDLRFGPG
VEGTRLTNGADATAEIKRTMEKSPHVLVVTNYDTDADILGAIEAGALGYLLKDAPPEELL
AAVRSAAEGDSTLSPTVANRLMTRVRTPRTSLTPRELEVLKLVAGGSSNRDIGRVLLLSE
ATVKSHLVHIYDKLGVRSRTSAVAIAREQGVL
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgattcgagttttgcttgccgacgaccacgagatcgttcgacttggtctgcgtgcagtt
ttagaaagcgcggatgatatcgaggttatcggtgaggtagccaccgcagaaggcgctata
gcggcagcccaagcgggtggcatcgatgtgattctcatggacctacgctttgggccaggg
gtagagggcactcggctgaccaacggtgccgacgctacagctgagataaaacggaccatg
gaaaaatcgcctcacgtattggtggtaaccaactatgacaccgacgcagatatcttgggc
gcgattgaagcaggcgcacttggctatctgcttaaggacgctccgccggaagaattgctt
gctgcagttcgttctgccgctgaaggcgactccacgctttcccccacggtagccaaccgt
ctgatgacgcgcgtccgcaccccgcgtacctcattgaccccacgggagctagaggtattg
aaattggtggctggaggttcctccaaccgcgatattggtcgtgttctcttgctctctgag
gctacagtgaagagccatcttgttcatatctatgacaagctgggtgttcgctcgcgtacc
tcggcggtcgcgattgctcgggagcaaggcgttttgtag

DBGET integrated database retrieval system