KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2014Help
Entry
Cp1002_2014       CDS       T01876                                 

Gene name
rluC
Definition
(GenBank) Ribosomal pseudouridine synthase
  KO
K06177  
tRNA pseudouridine32 synthase / 23S rRNA pseudouridine746 synthase [EC:5.4.99.28 5.4.99.29]
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Brite
Enzymes [BR:cpk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.28  tRNA pseudouridine32 synthase
     Cp1002_2014 (rluC)
    5.4.99.29  23S rRNA pseudouridine746 synthase
     Cp1002_2014 (rluC)
Ribosome biogenesis [BR:cpk03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    Cp1002_2014 (rluC)
Transfer RNA biogenesis [BR:cpk03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    Cp1002_2014 (rluC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2224678..2225655
Genome map
AA seq 325 aa AA seqDB search
MEDRVVHFPRGQAPLPVKNGLNPTRVRVSEEHAGMSAYEFVWHLIASQRRRHPDDTTEAL
LSRFQGDQVIIGPKFRIASPESTLKANEDIWFYRTPAPEIPVPYSCETIYEDDNLLVVNK
PPFLATMPRGKHITQTATVQMRRATGNGDLSPAHRLDRLTSGILVFTKNRKVRGAYQSLF
AERKVTKTYHAIAPFSEDLTGNTLWRDHMIKTPGDMQGHIVPGPPNAETLLVDVTELDAQ
ETAQLQKLHHVTTPLARYTLQPHTGRTHQLRLHMWAAGVPILGDPAYPVILAEEVEDFRV
PMHLTAYQLTFLDPFSNTPRCFTLQ
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggaagatagggtagtacactttcctcgcggtcaagcacctttaccggtaaaaaatggt
ctcaaccccaccagggtgagggtatccgaagaacacgccgggatgagcgcctacgagttt
gtatggcacctcatagcgtcgcaacgccgtcgtcaccctgacgacaccaccgaggcactc
cttagccgctttcagggcgaccaggtgatcatcggccctaagttccgcatagccagccca
gagtcaacgctcaaagccaacgaggatatctggttctaccgcaccccggctccggaaata
ccggtcccatacagctgcgaaaccatttacgaggacgacaatctccttgtggtgaataaa
ccgccattcctggccaccatgccgcgaggaaagcacattacccaaaccgccaccgtgcag
atgcgtcgcgcgaccggcaacggcgatctctcgcctgcgcaccgtctcgaccgcctcacc
tctggcatcttggttttcaccaagaaccgtaaagttcgcggcgcttatcaaagcctcttc
gccgagcgaaaagtaaccaaaacttaccatgcgatcgcgcccttcagtgaagacttaacc
ggtaatactctctggcgcgaccacatgatcaaaacaccaggcgatatgcaaggtcacatc
gtcccaggccccccaaacgccgagactttgcttgtcgacgtcaccgagctcgacgcacaa
gaaacagcacagttacagaagctccaccacgtcaccacacccctggcacgttatacgctt
caaccgcacacgggacgcacccaccagctacgtctgcatatgtgggcagctggtgttcct
atcctaggggatcccgcctaccccgttattcttgcagaagaagtagaagatttccgggtg
cctatgcacctcacggcttatcaactcaccttcctagaccccttcagtaacaccccccgg
tgttttaccttgcaataa

DBGET integrated database retrieval system